Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LGD2

Protein Details
Accession E2LGD2    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
56-75EAQRDRRKRGTEPKPRWFKQBasic
NLS Segment(s)
PositionSequence
61-69RRKRGTEPK
Subcellular Location(s) cyto 12.5, cyto_nucl 11, nucl 8.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037239  OSBP_sf  
IPR000648  Oxysterol-bd  
Gene Ontology GO:0008289  F:lipid binding  
KEGG mpr:MPER_05497  -  
Pfam View protein in Pfam  
PF01237  Oxysterol_BP  
Amino Acid Sequences MHEYYGFTSFSITLNEITNDITGKLPPTDSRLRPDVRALEEGDLDTAEAEKSRVEEAQRDRRKRGTEPKPRWFKQQGEEWVYAGGYWEARARGWKGVDVKPLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.14
4 0.14
5 0.13
6 0.12
7 0.11
8 0.11
9 0.1
10 0.11
11 0.11
12 0.12
13 0.12
14 0.18
15 0.25
16 0.27
17 0.31
18 0.36
19 0.37
20 0.37
21 0.41
22 0.39
23 0.34
24 0.34
25 0.3
26 0.24
27 0.22
28 0.21
29 0.16
30 0.12
31 0.08
32 0.06
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.07
41 0.07
42 0.13
43 0.21
44 0.32
45 0.4
46 0.44
47 0.47
48 0.51
49 0.55
50 0.57
51 0.6
52 0.6
53 0.63
54 0.69
55 0.76
56 0.81
57 0.78
58 0.8
59 0.76
60 0.7
61 0.65
62 0.65
63 0.63
64 0.59
65 0.58
66 0.49
67 0.42
68 0.37
69 0.3
70 0.22
71 0.14
72 0.08
73 0.08
74 0.1
75 0.1
76 0.11
77 0.16
78 0.18
79 0.23
80 0.24
81 0.29
82 0.33
83 0.38