Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0L7H0

Protein Details
Accession J0L7H0   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
151-176IYYAYRVERREQEKKRQERKLLNFRRHydrophilic
NLS Segment(s)
PositionSequence
164-169KKRQER
Subcellular Location(s) nucl 10, cyto 8, pero 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005162  Retrotrans_gag_dom  
KEGG adl:AURDEDRAFT_178695  -  
Pfam View protein in Pfam  
PF03732  Retrotrans_gag  
Amino Acid Sequences MPQYDGTADYDQFEAFVSKWDSWLRSKDLKDKEAVEYLRHALTGKASTWYTNHVAMQLKGWSMMKVYKEMYESCFPVNFREDLRDKMMAATQHGRPIKDYAKELENMSLRYDDIDKGTVKRILWDGVDDYIRLYWIEKGLSLEFSDVPTLIYYAYRVERREQEKKRQERKLLNFRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.09
3 0.14
4 0.16
5 0.15
6 0.19
7 0.22
8 0.24
9 0.28
10 0.33
11 0.34
12 0.39
13 0.43
14 0.49
15 0.54
16 0.54
17 0.53
18 0.51
19 0.48
20 0.48
21 0.44
22 0.37
23 0.32
24 0.31
25 0.27
26 0.25
27 0.21
28 0.14
29 0.16
30 0.16
31 0.14
32 0.15
33 0.15
34 0.16
35 0.16
36 0.2
37 0.2
38 0.19
39 0.19
40 0.19
41 0.21
42 0.2
43 0.21
44 0.18
45 0.16
46 0.16
47 0.16
48 0.12
49 0.11
50 0.14
51 0.13
52 0.15
53 0.15
54 0.15
55 0.17
56 0.18
57 0.21
58 0.2
59 0.2
60 0.18
61 0.19
62 0.18
63 0.18
64 0.19
65 0.16
66 0.14
67 0.18
68 0.19
69 0.2
70 0.22
71 0.21
72 0.19
73 0.19
74 0.2
75 0.15
76 0.15
77 0.16
78 0.14
79 0.2
80 0.21
81 0.21
82 0.2
83 0.23
84 0.25
85 0.24
86 0.25
87 0.22
88 0.23
89 0.24
90 0.23
91 0.24
92 0.22
93 0.2
94 0.19
95 0.17
96 0.15
97 0.15
98 0.15
99 0.11
100 0.1
101 0.12
102 0.13
103 0.14
104 0.17
105 0.19
106 0.18
107 0.2
108 0.2
109 0.19
110 0.18
111 0.19
112 0.16
113 0.16
114 0.16
115 0.14
116 0.13
117 0.11
118 0.11
119 0.1
120 0.09
121 0.09
122 0.1
123 0.1
124 0.1
125 0.13
126 0.14
127 0.15
128 0.14
129 0.14
130 0.13
131 0.13
132 0.13
133 0.1
134 0.1
135 0.09
136 0.09
137 0.08
138 0.08
139 0.07
140 0.1
141 0.16
142 0.2
143 0.22
144 0.28
145 0.36
146 0.45
147 0.55
148 0.6
149 0.66
150 0.72
151 0.81
152 0.86
153 0.87
154 0.88
155 0.88
156 0.91