Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2W722

Protein Details
Accession A0A1Y2W722    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-35NHITTTTTTTKKKKRKKIYQKTYNTWYSHydrophilic
NLS Segment(s)
PositionSequence
18-24KKKKRKK
Subcellular Location(s) nucl 19, mito_nucl 14.166, cyto_nucl 11.166, mito 7
Family & Domain DBs
Amino Acid Sequences MDWMWKNNHITTTTTTTKKKKRKKIYQKTYNTWYSPIVTDPTTNQAVTGLSRWESGRDPEFSRSCGRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.52
4 0.6
5 0.67
6 0.73
7 0.76
8 0.81
9 0.86
10 0.9
11 0.92
12 0.94
13 0.94
14 0.93
15 0.89
16 0.85
17 0.79
18 0.68
19 0.59
20 0.48
21 0.38
22 0.3
23 0.24
24 0.18
25 0.13
26 0.13
27 0.12
28 0.15
29 0.16
30 0.15
31 0.13
32 0.12
33 0.12
34 0.12
35 0.13
36 0.1
37 0.1
38 0.12
39 0.12
40 0.14
41 0.16
42 0.2
43 0.23
44 0.25
45 0.28
46 0.34
47 0.36
48 0.37