Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2WAX4

Protein Details
Accession A0A1Y2WAX4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAKSARSSTRKSNNQRLKANVFHydrophilic
80-111VDTAKPTSSKRNDKKRIEKRRKGKAVFSKSGSHydrophilic
NLS Segment(s)
PositionSequence
88-117SKRNDKKRIEKRRKGKAVFSKSGSKKTKKR
Subcellular Location(s) mito 16.5, mito_nucl 13.833, nucl 10, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSARSSTRKSNNQRLKANVFGPIEAARAERLSAKLLELAAQPKPEAPESSEMKIADENVEETKTDDATDGPTVAAMDVDTAKPTSSKRNDKKRIEKRRKGKAVFSKSGSKKTKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.82
4 0.77
5 0.72
6 0.64
7 0.6
8 0.51
9 0.41
10 0.36
11 0.29
12 0.24
13 0.18
14 0.18
15 0.11
16 0.1
17 0.11
18 0.11
19 0.11
20 0.13
21 0.13
22 0.12
23 0.13
24 0.12
25 0.13
26 0.13
27 0.14
28 0.13
29 0.14
30 0.13
31 0.13
32 0.15
33 0.14
34 0.14
35 0.13
36 0.18
37 0.2
38 0.22
39 0.23
40 0.21
41 0.21
42 0.2
43 0.18
44 0.13
45 0.1
46 0.09
47 0.07
48 0.08
49 0.07
50 0.08
51 0.08
52 0.07
53 0.07
54 0.07
55 0.06
56 0.08
57 0.08
58 0.08
59 0.07
60 0.07
61 0.07
62 0.06
63 0.06
64 0.04
65 0.04
66 0.05
67 0.05
68 0.06
69 0.06
70 0.07
71 0.08
72 0.1
73 0.19
74 0.27
75 0.38
76 0.48
77 0.59
78 0.69
79 0.78
80 0.88
81 0.9
82 0.92
83 0.93
84 0.93
85 0.92
86 0.93
87 0.93
88 0.88
89 0.87
90 0.86
91 0.85
92 0.82
93 0.77
94 0.76
95 0.72
96 0.77
97 0.76