Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2WDD6

Protein Details
Accession A0A1Y2WDD6   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-38LWKTPWRLSKFQKARQRMRLRGVHydrophilic
77-103KYTIFDRKEKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
84-96KEKRYRKGIHKLP
Subcellular Location(s) mito 22.5, cyto_mito 12.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRATNTLFGGLLWKTPWRLSKFQKARQRMRLRGVDAVVATLDSALAKKGETLKALETWKETMPTEAEMLPKDKYTIFDRKEKRYRKGIHKLPKWTRVSQRLNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.14
5 0.15
6 0.19
7 0.27
8 0.29
9 0.38
10 0.43
11 0.53
12 0.61
13 0.68
14 0.74
15 0.77
16 0.8
17 0.83
18 0.86
19 0.81
20 0.8
21 0.77
22 0.7
23 0.63
24 0.54
25 0.45
26 0.35
27 0.28
28 0.2
29 0.13
30 0.1
31 0.06
32 0.05
33 0.03
34 0.03
35 0.03
36 0.04
37 0.04
38 0.05
39 0.08
40 0.1
41 0.11
42 0.12
43 0.13
44 0.16
45 0.17
46 0.17
47 0.16
48 0.16
49 0.16
50 0.17
51 0.16
52 0.13
53 0.13
54 0.13
55 0.13
56 0.12
57 0.13
58 0.12
59 0.14
60 0.14
61 0.13
62 0.13
63 0.12
64 0.14
65 0.19
66 0.27
67 0.29
68 0.38
69 0.44
70 0.54
71 0.63
72 0.68
73 0.7
74 0.71
75 0.77
76 0.78
77 0.82
78 0.82
79 0.83
80 0.83
81 0.87
82 0.86
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79