Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J0LDR5

Protein Details
Accession J0LDR5    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
94-114IDETRPKAERRKELKTKYFFTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12, cyto_nucl 10.5, nucl 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
KEGG adl:AURDEDRAFT_75805  -  
Pfam View protein in Pfam  
PF00856  SET  
PROSITE View protein in PROSITE  
PS50280  SET  
CDD cd20071  SET_SMYD  
Amino Acid Sequences MHPKVAAAYDSLYNCKPYVGPLVSNRHGILRTNGFEATFDGILGERAFIAVMQIMSRANHSCKPNTKSCRQKYQATYTASRDIAPGEEITVTYIDETRPKAERRKELKTKYFFTCTCELCGPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.19
4 0.17
5 0.23
6 0.22
7 0.25
8 0.3
9 0.39
10 0.4
11 0.42
12 0.4
13 0.35
14 0.34
15 0.31
16 0.29
17 0.26
18 0.26
19 0.26
20 0.25
21 0.23
22 0.22
23 0.21
24 0.18
25 0.12
26 0.1
27 0.08
28 0.08
29 0.09
30 0.08
31 0.07
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.07
44 0.08
45 0.1
46 0.15
47 0.17
48 0.21
49 0.28
50 0.33
51 0.41
52 0.45
53 0.52
54 0.58
55 0.62
56 0.69
57 0.66
58 0.69
59 0.67
60 0.7
61 0.68
62 0.62
63 0.59
64 0.51
65 0.51
66 0.44
67 0.37
68 0.29
69 0.22
70 0.18
71 0.15
72 0.12
73 0.08
74 0.08
75 0.07
76 0.08
77 0.08
78 0.07
79 0.06
80 0.07
81 0.07
82 0.11
83 0.13
84 0.15
85 0.21
86 0.26
87 0.35
88 0.43
89 0.53
90 0.57
91 0.66
92 0.73
93 0.78
94 0.83
95 0.82
96 0.79
97 0.76
98 0.76
99 0.66
100 0.61
101 0.58
102 0.5
103 0.47