Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2W9L1

Protein Details
Accession A0A1Y2W9L1    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
28-52LTEVKPTPKPQPKPIPQRPTPPKNEHydrophilic
103-127YQEVKPTPKPQPKPIPQRPTPPKNEHydrophilic
NLS Segment(s)
PositionSequence
34-73TPKPQPKPIPQRPTPPKNEAKPVSGPKPIPLRPTPPKGGK
85-92PKPKPRPR
109-148TPKPQPKPIPQRPTPPKNEAKPVSGPKPIPLRPTPPKGGK
Subcellular Location(s) mito 14, cyto 8, mito_nucl 8
Family & Domain DBs
Amino Acid Sequences MNQVDNGNGLQMVSLWTTVLSLKLKGGLTEVKPTPKPQPKPIPQRPTPPKNEAKPVSGPKPIPLRPTPPKGGKDAYILSINELGPKPKPRPRPVGPTPVQSAYQEVKPTPKPQPKPIPQRPTPPKNEAKPVSGPKPIPLRPTPPKGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.07
5 0.08
6 0.11
7 0.11
8 0.11
9 0.12
10 0.16
11 0.16
12 0.16
13 0.19
14 0.21
15 0.21
16 0.27
17 0.3
18 0.32
19 0.34
20 0.37
21 0.44
22 0.48
23 0.52
24 0.55
25 0.63
26 0.67
27 0.76
28 0.83
29 0.83
30 0.78
31 0.83
32 0.84
33 0.82
34 0.79
35 0.76
36 0.74
37 0.69
38 0.73
39 0.65
40 0.59
41 0.57
42 0.56
43 0.52
44 0.49
45 0.44
46 0.4
47 0.45
48 0.42
49 0.41
50 0.38
51 0.41
52 0.42
53 0.48
54 0.49
55 0.48
56 0.48
57 0.46
58 0.45
59 0.38
60 0.35
61 0.29
62 0.25
63 0.21
64 0.19
65 0.16
66 0.16
67 0.14
68 0.14
69 0.13
70 0.13
71 0.13
72 0.18
73 0.24
74 0.29
75 0.38
76 0.42
77 0.51
78 0.56
79 0.63
80 0.64
81 0.69
82 0.65
83 0.6
84 0.57
85 0.5
86 0.46
87 0.36
88 0.34
89 0.26
90 0.26
91 0.23
92 0.2
93 0.24
94 0.27
95 0.32
96 0.38
97 0.45
98 0.48
99 0.56
100 0.66
101 0.71
102 0.78
103 0.83
104 0.83
105 0.78
106 0.83
107 0.84
108 0.82
109 0.79
110 0.76
111 0.74
112 0.69
113 0.73
114 0.65
115 0.59
116 0.57
117 0.56
118 0.52
119 0.49
120 0.44
121 0.4
122 0.45
123 0.42
124 0.41
125 0.38
126 0.41
127 0.42
128 0.48