Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2W3Q7

Protein Details
Accession A0A1Y2W3Q7    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSMKVSRKSRSGRHKRVVKVVCTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 13.5, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MSMKVSRKSRSGRHKRVVKVVCTWFLYTAALFQPCFQPYAISPIIPIISRHPCHLEALSEVDLPFTCELYISPCSDELPEQAKKTPTCIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.85
4 0.82
5 0.75
6 0.72
7 0.66
8 0.6
9 0.54
10 0.48
11 0.38
12 0.32
13 0.28
14 0.2
15 0.16
16 0.14
17 0.12
18 0.11
19 0.11
20 0.14
21 0.13
22 0.15
23 0.13
24 0.12
25 0.11
26 0.17
27 0.17
28 0.13
29 0.13
30 0.12
31 0.13
32 0.12
33 0.12
34 0.1
35 0.17
36 0.17
37 0.19
38 0.21
39 0.21
40 0.23
41 0.23
42 0.2
43 0.14
44 0.17
45 0.17
46 0.14
47 0.13
48 0.12
49 0.12
50 0.12
51 0.11
52 0.08
53 0.07
54 0.06
55 0.07
56 0.1
57 0.13
58 0.12
59 0.13
60 0.13
61 0.14
62 0.15
63 0.16
64 0.16
65 0.21
66 0.24
67 0.25
68 0.3
69 0.36
70 0.36