Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2W329

Protein Details
Accession A0A1Y2W329   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-44NPKHEHSIHHHNKHSRKRRHHHHHHNTRESNHBasic
NLS Segment(s)
PositionSequence
25-32KHSRKRRH
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MRVSFDPNTQHNNPKHEHSIHHHNKHSRKRRHHHHHHNTRESNHRDSNHNDLHLPHPHNLQQRRPPVGRVLEPERTRATTRKTPPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.5
4 0.51
5 0.49
6 0.55
7 0.59
8 0.64
9 0.65
10 0.66
11 0.73
12 0.78
13 0.82
14 0.8
15 0.81
16 0.84
17 0.87
18 0.9
19 0.92
20 0.93
21 0.94
22 0.94
23 0.93
24 0.92
25 0.86
26 0.79
27 0.77
28 0.7
29 0.64
30 0.58
31 0.5
32 0.44
33 0.43
34 0.46
35 0.39
36 0.36
37 0.31
38 0.28
39 0.3
40 0.33
41 0.32
42 0.26
43 0.27
44 0.31
45 0.39
46 0.43
47 0.47
48 0.49
49 0.54
50 0.59
51 0.58
52 0.55
53 0.54
54 0.54
55 0.5
56 0.49
57 0.47
58 0.49
59 0.49
60 0.5
61 0.47
62 0.45
63 0.46
64 0.45
65 0.47
66 0.47