Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2W146

Protein Details
Accession A0A1Y2W146    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
52-73HHSRGARRERRTKYQNGKEKIFBasic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MALRKEESPEPGSMPLLNFETYRVLAHHPNAEPTDQTNPNPHARPHPVDFLHHSRGARRERRTKYQNGKEKIFIPQRAHVGYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.18
4 0.17
5 0.15
6 0.14
7 0.15
8 0.15
9 0.15
10 0.13
11 0.14
12 0.16
13 0.19
14 0.23
15 0.21
16 0.23
17 0.24
18 0.23
19 0.21
20 0.2
21 0.24
22 0.21
23 0.21
24 0.23
25 0.25
26 0.29
27 0.3
28 0.29
29 0.29
30 0.31
31 0.35
32 0.33
33 0.36
34 0.32
35 0.33
36 0.37
37 0.37
38 0.37
39 0.35
40 0.33
41 0.31
42 0.38
43 0.45
44 0.47
45 0.5
46 0.56
47 0.61
48 0.71
49 0.75
50 0.78
51 0.8
52 0.82
53 0.83
54 0.8
55 0.78
56 0.72
57 0.66
58 0.66
59 0.63
60 0.6
61 0.55
62 0.54
63 0.55