Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2W861

Protein Details
Accession A0A1Y2W861   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-29APNQTPNRRRNGPGGRPRNTPKQTHydrophilic
55-87PSSVRPSSTNPKRRSGKKNNNTKKTPRNKDGVAHydrophilic
NLS Segment(s)
PositionSequence
65-82PKRRSGKKNNNTKKTPRN
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Pfam View protein in Pfam  
PF15365  PNRC  
Amino Acid Sequences MELAQAPNQTPNRRRNGPGGRPRNTPKQTRYASENDIPTYRPDHVGSPSTPNLDPSSVRPSSTNPKRRSGKKNNNTKKTPRNKDGVAPLDRNNSDRKSPSLQPKEAPMPIYAGSTFHASPAASALPIPMFLNKLTSDSSGTKAASSPEEGLSCPSTDSDEASSASPPSVPRTDESPLEFFFRADRAEKEARVRRASSVHTDAPALSPLSPFHEAHRSLKEYSPFPIASPPDRVRRPKNTSYSSTLISPEERGEVPGQPVGPAFSTPYQERMRAARSNQSSARSASKVLQSQDGISSDSLKRYLFTGRYAADNSQSQQSPTPPTPSNQGVQRRYEQNSPPAHRSMEQPEPTQNKLRQHHLPRGVFPAAVLTAHTQSSPSSIPPVQAQLSSFEPDQVSHMEDHLRRMLNIGSPGQSLSLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.71
3 0.75
4 0.76
5 0.79
6 0.8
7 0.76
8 0.79
9 0.82
10 0.82
11 0.79
12 0.78
13 0.74
14 0.74
15 0.74
16 0.71
17 0.7
18 0.66
19 0.65
20 0.62
21 0.59
22 0.52
23 0.48
24 0.44
25 0.4
26 0.37
27 0.32
28 0.28
29 0.26
30 0.26
31 0.29
32 0.33
33 0.32
34 0.36
35 0.36
36 0.37
37 0.35
38 0.34
39 0.32
40 0.29
41 0.28
42 0.25
43 0.31
44 0.28
45 0.28
46 0.27
47 0.31
48 0.39
49 0.49
50 0.54
51 0.51
52 0.6
53 0.69
54 0.77
55 0.83
56 0.83
57 0.84
58 0.84
59 0.9
60 0.91
61 0.92
62 0.91
63 0.9
64 0.9
65 0.89
66 0.9
67 0.86
68 0.82
69 0.75
70 0.73
71 0.72
72 0.7
73 0.65
74 0.59
75 0.55
76 0.55
77 0.53
78 0.48
79 0.45
80 0.39
81 0.38
82 0.37
83 0.38
84 0.36
85 0.43
86 0.52
87 0.55
88 0.56
89 0.53
90 0.56
91 0.57
92 0.53
93 0.47
94 0.37
95 0.3
96 0.27
97 0.26
98 0.2
99 0.15
100 0.13
101 0.14
102 0.14
103 0.11
104 0.12
105 0.1
106 0.1
107 0.11
108 0.1
109 0.07
110 0.07
111 0.08
112 0.07
113 0.07
114 0.08
115 0.07
116 0.08
117 0.08
118 0.1
119 0.1
120 0.12
121 0.12
122 0.13
123 0.16
124 0.16
125 0.18
126 0.19
127 0.18
128 0.17
129 0.17
130 0.17
131 0.15
132 0.15
133 0.14
134 0.13
135 0.14
136 0.13
137 0.15
138 0.14
139 0.13
140 0.11
141 0.1
142 0.1
143 0.1
144 0.11
145 0.1
146 0.1
147 0.11
148 0.11
149 0.12
150 0.1
151 0.1
152 0.1
153 0.09
154 0.12
155 0.13
156 0.14
157 0.14
158 0.18
159 0.2
160 0.2
161 0.23
162 0.21
163 0.2
164 0.22
165 0.21
166 0.17
167 0.16
168 0.15
169 0.14
170 0.14
171 0.14
172 0.17
173 0.19
174 0.21
175 0.28
176 0.34
177 0.38
178 0.39
179 0.39
180 0.35
181 0.36
182 0.36
183 0.34
184 0.32
185 0.28
186 0.25
187 0.24
188 0.22
189 0.2
190 0.18
191 0.13
192 0.08
193 0.08
194 0.07
195 0.1
196 0.13
197 0.13
198 0.14
199 0.19
200 0.21
201 0.24
202 0.28
203 0.27
204 0.27
205 0.29
206 0.3
207 0.25
208 0.25
209 0.26
210 0.22
211 0.19
212 0.22
213 0.21
214 0.2
215 0.26
216 0.28
217 0.31
218 0.37
219 0.43
220 0.46
221 0.54
222 0.6
223 0.61
224 0.66
225 0.64
226 0.63
227 0.63
228 0.58
229 0.49
230 0.43
231 0.36
232 0.28
233 0.23
234 0.19
235 0.14
236 0.13
237 0.12
238 0.12
239 0.12
240 0.12
241 0.13
242 0.13
243 0.13
244 0.11
245 0.11
246 0.1
247 0.09
248 0.08
249 0.09
250 0.09
251 0.13
252 0.13
253 0.19
254 0.21
255 0.22
256 0.23
257 0.25
258 0.28
259 0.3
260 0.32
261 0.34
262 0.36
263 0.4
264 0.41
265 0.41
266 0.38
267 0.36
268 0.38
269 0.31
270 0.29
271 0.27
272 0.29
273 0.3
274 0.29
275 0.3
276 0.26
277 0.26
278 0.27
279 0.24
280 0.2
281 0.16
282 0.18
283 0.16
284 0.17
285 0.17
286 0.15
287 0.14
288 0.14
289 0.2
290 0.18
291 0.19
292 0.22
293 0.22
294 0.25
295 0.26
296 0.26
297 0.24
298 0.25
299 0.24
300 0.25
301 0.25
302 0.23
303 0.24
304 0.25
305 0.28
306 0.28
307 0.33
308 0.29
309 0.3
310 0.35
311 0.35
312 0.37
313 0.38
314 0.45
315 0.45
316 0.48
317 0.53
318 0.53
319 0.54
320 0.58
321 0.55
322 0.54
323 0.58
324 0.59
325 0.57
326 0.54
327 0.52
328 0.46
329 0.46
330 0.44
331 0.45
332 0.43
333 0.41
334 0.46
335 0.48
336 0.51
337 0.55
338 0.53
339 0.53
340 0.55
341 0.59
342 0.6
343 0.64
344 0.69
345 0.7
346 0.69
347 0.63
348 0.65
349 0.59
350 0.48
351 0.4
352 0.33
353 0.24
354 0.2
355 0.18
356 0.14
357 0.14
358 0.14
359 0.14
360 0.12
361 0.12
362 0.15
363 0.15
364 0.14
365 0.18
366 0.19
367 0.21
368 0.23
369 0.27
370 0.25
371 0.26
372 0.25
373 0.23
374 0.25
375 0.26
376 0.24
377 0.22
378 0.21
379 0.2
380 0.21
381 0.2
382 0.19
383 0.16
384 0.18
385 0.23
386 0.24
387 0.28
388 0.33
389 0.33
390 0.3
391 0.32
392 0.33
393 0.3
394 0.33
395 0.32
396 0.27
397 0.26
398 0.27