Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2W0U3

Protein Details
Accession A0A1Y2W0U3    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
27-50VMETRWSIREKKRNKNKNKEEGEGHydrophilic
NLS Segment(s)
PositionSequence
36-43EKKRNKNK
Subcellular Location(s) cyto 23, nucl 2, mito 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences SSVVSREEFVDFRDGLWVRIRSPLAVVMETRWSIREKKRNKNKNKEEGEGEGEGEGREVELELVEEVDISCSKLLLGIVKGQVDNNWKGIHAKIIGRLVEDVKGKTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.28
4 0.27
5 0.24
6 0.3
7 0.3
8 0.23
9 0.24
10 0.26
11 0.2
12 0.2
13 0.2
14 0.15
15 0.18
16 0.18
17 0.17
18 0.15
19 0.15
20 0.21
21 0.3
22 0.38
23 0.44
24 0.55
25 0.66
26 0.75
27 0.83
28 0.88
29 0.89
30 0.9
31 0.86
32 0.79
33 0.71
34 0.64
35 0.56
36 0.45
37 0.35
38 0.24
39 0.18
40 0.14
41 0.11
42 0.07
43 0.04
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.04
55 0.04
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.06
62 0.07
63 0.08
64 0.1
65 0.12
66 0.13
67 0.14
68 0.14
69 0.17
70 0.2
71 0.21
72 0.21
73 0.19
74 0.19
75 0.21
76 0.21
77 0.23
78 0.21
79 0.22
80 0.25
81 0.29
82 0.29
83 0.29
84 0.3
85 0.27
86 0.28
87 0.29
88 0.25