Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A218ZC96

Protein Details
Accession A0A218ZC96    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-57EKEERKREYNRLAQREFRRRRKEHLKNLEQAQREBasic
NLS Segment(s)
PositionSequence
37-45QREFRRRRK
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
IPR021833  DUF3425  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF11905  DUF3425  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MTPSTTSNRHSGQYSLGDMDSAAEKEERKREYNRLAQREFRRRRKEHLKNLEQAQREQSSEQSGEIERLRYQNEELRRENEALRAQMYASSSASSHLVSASISVPSLAGDARRYSLSPSLSGTSLSGTGSPPATLGLDMMPMAALSLTSSMLPSSMNAYADPAAFSSQPYSVVHPSGLRPNSQSSPDSSGFRDSRSPMGPALQPLNASQPDARAPPLQGPRRASVPASSMVVAPYDRTKARTEIREAFRRYSDPAITSDPQRHLVVLRGMSHGLPAALKPSQAQLETPHYYGIDMIASPSLRERLMALDQDVARNFVAELGMTGGDGSGVAQVIIWGDEALNEATWELSQPLLERWGWLLGPEWLQRANFWRRQRGAPLLPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.27
4 0.24
5 0.21
6 0.21
7 0.18
8 0.14
9 0.13
10 0.13
11 0.15
12 0.22
13 0.3
14 0.34
15 0.37
16 0.44
17 0.51
18 0.59
19 0.67
20 0.7
21 0.73
22 0.73
23 0.77
24 0.81
25 0.83
26 0.84
27 0.84
28 0.85
29 0.8
30 0.85
31 0.87
32 0.87
33 0.87
34 0.88
35 0.86
36 0.83
37 0.87
38 0.84
39 0.76
40 0.68
41 0.64
42 0.56
43 0.48
44 0.41
45 0.35
46 0.32
47 0.3
48 0.27
49 0.22
50 0.2
51 0.22
52 0.22
53 0.22
54 0.2
55 0.22
56 0.23
57 0.22
58 0.25
59 0.28
60 0.34
61 0.39
62 0.4
63 0.41
64 0.43
65 0.43
66 0.41
67 0.41
68 0.37
69 0.31
70 0.28
71 0.25
72 0.21
73 0.21
74 0.21
75 0.17
76 0.13
77 0.12
78 0.11
79 0.12
80 0.13
81 0.11
82 0.09
83 0.08
84 0.08
85 0.07
86 0.08
87 0.08
88 0.07
89 0.07
90 0.07
91 0.06
92 0.06
93 0.07
94 0.06
95 0.06
96 0.08
97 0.09
98 0.1
99 0.11
100 0.12
101 0.13
102 0.18
103 0.18
104 0.17
105 0.18
106 0.18
107 0.18
108 0.18
109 0.16
110 0.12
111 0.11
112 0.1
113 0.09
114 0.07
115 0.08
116 0.08
117 0.08
118 0.07
119 0.07
120 0.07
121 0.06
122 0.06
123 0.05
124 0.05
125 0.05
126 0.05
127 0.04
128 0.04
129 0.04
130 0.03
131 0.03
132 0.02
133 0.03
134 0.03
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.05
141 0.07
142 0.08
143 0.08
144 0.08
145 0.09
146 0.1
147 0.1
148 0.1
149 0.08
150 0.07
151 0.07
152 0.07
153 0.08
154 0.07
155 0.09
156 0.09
157 0.12
158 0.12
159 0.13
160 0.13
161 0.13
162 0.14
163 0.19
164 0.2
165 0.18
166 0.18
167 0.21
168 0.22
169 0.24
170 0.23
171 0.19
172 0.24
173 0.25
174 0.25
175 0.22
176 0.26
177 0.24
178 0.24
179 0.24
180 0.19
181 0.21
182 0.21
183 0.21
184 0.16
185 0.18
186 0.17
187 0.17
188 0.17
189 0.14
190 0.13
191 0.13
192 0.16
193 0.14
194 0.14
195 0.12
196 0.12
197 0.13
198 0.13
199 0.14
200 0.12
201 0.12
202 0.18
203 0.26
204 0.3
205 0.34
206 0.36
207 0.36
208 0.37
209 0.38
210 0.32
211 0.25
212 0.22
213 0.19
214 0.17
215 0.16
216 0.13
217 0.12
218 0.12
219 0.1
220 0.09
221 0.09
222 0.11
223 0.11
224 0.14
225 0.16
226 0.21
227 0.26
228 0.31
229 0.35
230 0.41
231 0.48
232 0.54
233 0.55
234 0.52
235 0.49
236 0.45
237 0.42
238 0.37
239 0.32
240 0.25
241 0.24
242 0.27
243 0.26
244 0.28
245 0.3
246 0.28
247 0.29
248 0.28
249 0.26
250 0.21
251 0.23
252 0.25
253 0.22
254 0.21
255 0.19
256 0.2
257 0.19
258 0.19
259 0.15
260 0.11
261 0.09
262 0.07
263 0.09
264 0.09
265 0.09
266 0.1
267 0.12
268 0.15
269 0.15
270 0.16
271 0.17
272 0.24
273 0.26
274 0.26
275 0.24
276 0.22
277 0.21
278 0.2
279 0.16
280 0.1
281 0.07
282 0.07
283 0.08
284 0.08
285 0.08
286 0.1
287 0.11
288 0.1
289 0.11
290 0.11
291 0.13
292 0.16
293 0.18
294 0.17
295 0.21
296 0.22
297 0.25
298 0.24
299 0.22
300 0.19
301 0.17
302 0.16
303 0.11
304 0.11
305 0.07
306 0.07
307 0.07
308 0.07
309 0.06
310 0.06
311 0.05
312 0.05
313 0.05
314 0.05
315 0.04
316 0.04
317 0.04
318 0.04
319 0.04
320 0.05
321 0.05
322 0.05
323 0.04
324 0.04
325 0.05
326 0.07
327 0.08
328 0.07
329 0.07
330 0.07
331 0.07
332 0.07
333 0.08
334 0.07
335 0.07
336 0.08
337 0.09
338 0.11
339 0.14
340 0.14
341 0.14
342 0.15
343 0.18
344 0.17
345 0.16
346 0.16
347 0.16
348 0.21
349 0.22
350 0.23
351 0.23
352 0.24
353 0.26
354 0.32
355 0.39
356 0.42
357 0.48
358 0.56
359 0.58
360 0.65
361 0.7
362 0.71
363 0.69