Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A218Z0W5

Protein Details
Accession A0A218Z0W5    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-33GIPPRSARHSQPRFPRKRAPINGIRTFPHydrophilic
NLS Segment(s)
PositionSequence
21-22RK
Subcellular Location(s) mito 20, nucl 4.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MLSCAGIPPRSARHSQPRFPRKRAPINGIRTFPSKPDAPPASSHHITSLHITTSSAWACCSTSPVLLSRNSFICGDLCPSPLDCTSPSYAVHPILSGTRGQHDPSLAWPKPQLKVKVKVKVKVKLEVRPQLTPQLKPMLKGMSRPTCYHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.62
3 0.69
4 0.73
5 0.78
6 0.81
7 0.83
8 0.82
9 0.84
10 0.83
11 0.82
12 0.8
13 0.8
14 0.8
15 0.73
16 0.66
17 0.58
18 0.51
19 0.43
20 0.38
21 0.31
22 0.25
23 0.31
24 0.31
25 0.3
26 0.33
27 0.37
28 0.41
29 0.39
30 0.38
31 0.32
32 0.29
33 0.28
34 0.27
35 0.23
36 0.15
37 0.14
38 0.14
39 0.12
40 0.15
41 0.15
42 0.12
43 0.1
44 0.1
45 0.11
46 0.1
47 0.12
48 0.09
49 0.09
50 0.1
51 0.11
52 0.13
53 0.15
54 0.16
55 0.15
56 0.15
57 0.16
58 0.15
59 0.14
60 0.12
61 0.1
62 0.12
63 0.1
64 0.1
65 0.09
66 0.1
67 0.11
68 0.1
69 0.12
70 0.1
71 0.12
72 0.12
73 0.13
74 0.13
75 0.14
76 0.15
77 0.15
78 0.14
79 0.11
80 0.11
81 0.1
82 0.11
83 0.1
84 0.09
85 0.12
86 0.13
87 0.14
88 0.14
89 0.14
90 0.14
91 0.19
92 0.28
93 0.25
94 0.25
95 0.29
96 0.32
97 0.38
98 0.44
99 0.48
100 0.46
101 0.57
102 0.64
103 0.69
104 0.71
105 0.73
106 0.74
107 0.73
108 0.69
109 0.68
110 0.65
111 0.63
112 0.66
113 0.67
114 0.63
115 0.59
116 0.57
117 0.58
118 0.57
119 0.51
120 0.46
121 0.48
122 0.44
123 0.41
124 0.43
125 0.42
126 0.39
127 0.43
128 0.48
129 0.48
130 0.51