Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0WM40

Protein Details
Accession J0WM40    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-31QSQPTQKSYGRRRRAAQDSDSHydrophilic
384-420DEELPPRQRRERGQEREKEREKKRKTKEIMLKDVRCABasic
NLS Segment(s)
PositionSequence
390-410RQRRERGQEREKEREKKRKTK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR037445  MAGE  
IPR041898  MAGE_WH1  
IPR041899  MAGE_WH2  
IPR002190  MHD_dom  
KEGG adl:AURDEDRAFT_178042  -  
Pfam View protein in Pfam  
PF01454  MAGE  
Amino Acid Sequences MPARASRRASQSQPTQKSYGRRRRAAQDSDSEPEQQNGRDDDDDDDAEEEDHPRRGAKASWAAQTRRAAQSQRRRHDPSGESAGDGDEDESGLFSRALVRMALAQEFKRTALRRDNINKKVLKGDSREFKAVFDKTQLTLRRTFGFELVELVSRNERERILHGKDPEPATQDGKKKAAQPTMTKQYVLRSSLKPELIAAASVIDREVAALEAAERAKDEQLGLARDETDPVPEGSILAQLDYDTMGPHSLGVLHVVLALIIVSGRTINEFQLGNMLKKMGVTQNSHIRLPITATTPSISLENWFTMMIRQGYLDRLQTLAGGATATQGKRRMRARINADEESNDVYELRWGERAHAEISEKAVADWIVDFMLDAEAELEDEDEDEELPPRQRRERGQEREKEREKKRKTKEIMLKDVRCAAGGLEDYHGLKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.69
3 0.67
4 0.72
5 0.74
6 0.74
7 0.73
8 0.73
9 0.75
10 0.79
11 0.83
12 0.81
13 0.77
14 0.74
15 0.7
16 0.67
17 0.62
18 0.55
19 0.47
20 0.42
21 0.38
22 0.31
23 0.3
24 0.28
25 0.29
26 0.27
27 0.27
28 0.26
29 0.27
30 0.25
31 0.21
32 0.19
33 0.16
34 0.15
35 0.15
36 0.14
37 0.13
38 0.15
39 0.15
40 0.15
41 0.17
42 0.19
43 0.21
44 0.27
45 0.34
46 0.36
47 0.43
48 0.5
49 0.5
50 0.54
51 0.56
52 0.54
53 0.5
54 0.5
55 0.5
56 0.53
57 0.61
58 0.66
59 0.69
60 0.73
61 0.75
62 0.74
63 0.76
64 0.7
65 0.66
66 0.64
67 0.56
68 0.47
69 0.4
70 0.36
71 0.27
72 0.23
73 0.16
74 0.07
75 0.06
76 0.05
77 0.05
78 0.06
79 0.06
80 0.06
81 0.06
82 0.08
83 0.09
84 0.1
85 0.1
86 0.1
87 0.12
88 0.13
89 0.16
90 0.16
91 0.16
92 0.18
93 0.19
94 0.2
95 0.24
96 0.25
97 0.28
98 0.35
99 0.39
100 0.45
101 0.55
102 0.64
103 0.64
104 0.7
105 0.66
106 0.59
107 0.62
108 0.57
109 0.53
110 0.48
111 0.5
112 0.5
113 0.52
114 0.54
115 0.46
116 0.44
117 0.44
118 0.4
119 0.33
120 0.28
121 0.26
122 0.23
123 0.3
124 0.33
125 0.3
126 0.33
127 0.34
128 0.33
129 0.33
130 0.32
131 0.27
132 0.23
133 0.2
134 0.18
135 0.16
136 0.15
137 0.13
138 0.13
139 0.13
140 0.13
141 0.14
142 0.14
143 0.13
144 0.14
145 0.18
146 0.24
147 0.27
148 0.31
149 0.33
150 0.33
151 0.37
152 0.38
153 0.35
154 0.32
155 0.28
156 0.27
157 0.3
158 0.34
159 0.33
160 0.34
161 0.35
162 0.37
163 0.41
164 0.43
165 0.42
166 0.43
167 0.47
168 0.53
169 0.51
170 0.46
171 0.41
172 0.4
173 0.39
174 0.36
175 0.33
176 0.25
177 0.29
178 0.33
179 0.32
180 0.27
181 0.23
182 0.21
183 0.17
184 0.15
185 0.1
186 0.07
187 0.06
188 0.06
189 0.06
190 0.04
191 0.04
192 0.04
193 0.04
194 0.03
195 0.03
196 0.03
197 0.03
198 0.05
199 0.05
200 0.05
201 0.05
202 0.05
203 0.06
204 0.06
205 0.06
206 0.06
207 0.09
208 0.1
209 0.1
210 0.1
211 0.1
212 0.1
213 0.11
214 0.1
215 0.08
216 0.08
217 0.08
218 0.08
219 0.07
220 0.07
221 0.06
222 0.08
223 0.07
224 0.06
225 0.06
226 0.05
227 0.05
228 0.06
229 0.05
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.05
239 0.05
240 0.04
241 0.05
242 0.04
243 0.04
244 0.04
245 0.03
246 0.02
247 0.02
248 0.02
249 0.02
250 0.02
251 0.03
252 0.04
253 0.05
254 0.05
255 0.08
256 0.08
257 0.08
258 0.15
259 0.16
260 0.16
261 0.16
262 0.16
263 0.14
264 0.14
265 0.16
266 0.13
267 0.17
268 0.19
269 0.24
270 0.32
271 0.35
272 0.35
273 0.33
274 0.3
275 0.25
276 0.25
277 0.22
278 0.16
279 0.15
280 0.15
281 0.15
282 0.15
283 0.15
284 0.13
285 0.11
286 0.1
287 0.1
288 0.1
289 0.1
290 0.1
291 0.09
292 0.09
293 0.13
294 0.12
295 0.11
296 0.11
297 0.12
298 0.14
299 0.16
300 0.16
301 0.13
302 0.13
303 0.13
304 0.12
305 0.11
306 0.09
307 0.07
308 0.06
309 0.05
310 0.06
311 0.1
312 0.1
313 0.14
314 0.2
315 0.23
316 0.3
317 0.35
318 0.43
319 0.47
320 0.55
321 0.6
322 0.64
323 0.69
324 0.64
325 0.61
326 0.52
327 0.46
328 0.4
329 0.32
330 0.22
331 0.15
332 0.12
333 0.13
334 0.13
335 0.13
336 0.15
337 0.15
338 0.18
339 0.2
340 0.22
341 0.21
342 0.22
343 0.23
344 0.2
345 0.23
346 0.22
347 0.19
348 0.17
349 0.17
350 0.15
351 0.13
352 0.12
353 0.09
354 0.07
355 0.06
356 0.06
357 0.06
358 0.06
359 0.05
360 0.05
361 0.05
362 0.05
363 0.05
364 0.05
365 0.05
366 0.04
367 0.05
368 0.05
369 0.05
370 0.06
371 0.06
372 0.08
373 0.11
374 0.17
375 0.23
376 0.28
377 0.35
378 0.42
379 0.51
380 0.6
381 0.68
382 0.73
383 0.78
384 0.82
385 0.83
386 0.87
387 0.88
388 0.87
389 0.87
390 0.87
391 0.87
392 0.88
393 0.9
394 0.9
395 0.88
396 0.89
397 0.89
398 0.88
399 0.89
400 0.89
401 0.82
402 0.76
403 0.74
404 0.63
405 0.53
406 0.43
407 0.32
408 0.26
409 0.24
410 0.21
411 0.17
412 0.19