Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A218ZE85

Protein Details
Accession A0A218ZE85   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
78-117GERREKAGREDKRKKARDRERRDEDKRKKARDREWRDEWMBasic
NLS Segment(s)
PositionSequence
74-110VPKEGERREKAGREDKRKKARDRERRDEDKRKKARDR
Subcellular Location(s) mito 15.5, cyto_mito 10, nucl 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSQGMVEKKAWVVWLRPTHGFSGTRSLGWRAGGSHVNKKHGRLSALRDDPHAEPGDLGIGRQAARGDAERTGAVPKEGERREKAGREDKRKKARDRERRDEDKRKKARDREWRDEWMAIRPTPSGTLKTSPHLTSALPYLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.39
4 0.4
5 0.39
6 0.41
7 0.39
8 0.32
9 0.33
10 0.3
11 0.28
12 0.28
13 0.28
14 0.25
15 0.24
16 0.23
17 0.16
18 0.19
19 0.23
20 0.25
21 0.32
22 0.34
23 0.41
24 0.43
25 0.44
26 0.46
27 0.44
28 0.44
29 0.39
30 0.42
31 0.44
32 0.47
33 0.45
34 0.41
35 0.4
36 0.37
37 0.37
38 0.31
39 0.21
40 0.15
41 0.14
42 0.15
43 0.12
44 0.11
45 0.08
46 0.07
47 0.07
48 0.08
49 0.08
50 0.06
51 0.07
52 0.08
53 0.09
54 0.08
55 0.09
56 0.08
57 0.09
58 0.1
59 0.09
60 0.08
61 0.07
62 0.09
63 0.16
64 0.18
65 0.23
66 0.23
67 0.28
68 0.33
69 0.36
70 0.41
71 0.42
72 0.49
73 0.56
74 0.64
75 0.69
76 0.75
77 0.79
78 0.82
79 0.83
80 0.85
81 0.85
82 0.86
83 0.87
84 0.86
85 0.88
86 0.89
87 0.9
88 0.89
89 0.89
90 0.88
91 0.87
92 0.87
93 0.86
94 0.86
95 0.86
96 0.86
97 0.84
98 0.82
99 0.79
100 0.73
101 0.67
102 0.58
103 0.55
104 0.49
105 0.41
106 0.35
107 0.29
108 0.27
109 0.27
110 0.28
111 0.24
112 0.23
113 0.28
114 0.3
115 0.35
116 0.39
117 0.35
118 0.35
119 0.33
120 0.29
121 0.26