Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A218ZEM3

Protein Details
Accession A0A218ZEM3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
270-290LIALQKQKWLKKNPRMTVPVNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 21, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004686  Mtc  
Gene Ontology GO:0031966  C:mitochondrial membrane  
GO:0015075  F:monoatomic ion transmembrane transporter activity  
GO:0006865  P:amino acid transport  
Pfam View protein in Pfam  
PF03820  SFXNs  
Amino Acid Sequences MSASLPGGRELPVSKYDLSTYWGRVRHSADISDPRTLLVNRAGLEHAKNLVAGYKQGKIIEMNEELWKAKKIVDSTLHPDTGEPVFLPFRMSSFVLSNLVVTAGMLTPGLGMTGTLLWQIANQSLNVAINNANANKSTPLSISKIAQSYLLAVGASCSVALGLNAVVPRLKRVSPATKMVLTRLVPFAAVASAGALNVLLMRGEEIRQGIDIYPVLSEADKAKLAAEGKSESAVASLGKSKKAATLAVSETAVSRVLNSSPIMVFPPLVLIALQKQKWLKKNPRMTVPVNVGLIFATSMFALPLALAAFPQRQAVDASSLEEEFWGKGGENGKVVFNRGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.24
4 0.23
5 0.25
6 0.25
7 0.28
8 0.31
9 0.34
10 0.34
11 0.38
12 0.41
13 0.44
14 0.43
15 0.4
16 0.4
17 0.46
18 0.47
19 0.45
20 0.41
21 0.34
22 0.35
23 0.33
24 0.3
25 0.25
26 0.26
27 0.22
28 0.24
29 0.26
30 0.24
31 0.25
32 0.24
33 0.21
34 0.18
35 0.17
36 0.15
37 0.17
38 0.15
39 0.18
40 0.18
41 0.2
42 0.22
43 0.22
44 0.23
45 0.22
46 0.23
47 0.23
48 0.23
49 0.22
50 0.22
51 0.23
52 0.22
53 0.23
54 0.23
55 0.18
56 0.19
57 0.21
58 0.2
59 0.25
60 0.3
61 0.33
62 0.38
63 0.41
64 0.39
65 0.35
66 0.33
67 0.3
68 0.25
69 0.2
70 0.14
71 0.11
72 0.11
73 0.12
74 0.14
75 0.11
76 0.11
77 0.13
78 0.13
79 0.13
80 0.14
81 0.15
82 0.15
83 0.15
84 0.14
85 0.11
86 0.11
87 0.09
88 0.07
89 0.06
90 0.04
91 0.04
92 0.04
93 0.04
94 0.03
95 0.03
96 0.04
97 0.03
98 0.03
99 0.03
100 0.03
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.05
107 0.06
108 0.07
109 0.07
110 0.07
111 0.08
112 0.08
113 0.08
114 0.08
115 0.07
116 0.08
117 0.1
118 0.1
119 0.1
120 0.1
121 0.11
122 0.11
123 0.11
124 0.11
125 0.1
126 0.12
127 0.14
128 0.16
129 0.16
130 0.17
131 0.18
132 0.17
133 0.16
134 0.14
135 0.12
136 0.11
137 0.09
138 0.07
139 0.05
140 0.05
141 0.05
142 0.05
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.04
151 0.04
152 0.04
153 0.05
154 0.05
155 0.07
156 0.09
157 0.09
158 0.11
159 0.16
160 0.23
161 0.25
162 0.3
163 0.31
164 0.32
165 0.33
166 0.31
167 0.3
168 0.24
169 0.23
170 0.19
171 0.16
172 0.13
173 0.12
174 0.11
175 0.07
176 0.06
177 0.04
178 0.04
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.02
187 0.02
188 0.03
189 0.04
190 0.04
191 0.05
192 0.06
193 0.06
194 0.07
195 0.07
196 0.07
197 0.08
198 0.08
199 0.07
200 0.06
201 0.06
202 0.07
203 0.06
204 0.07
205 0.07
206 0.08
207 0.08
208 0.09
209 0.09
210 0.11
211 0.12
212 0.12
213 0.13
214 0.13
215 0.13
216 0.14
217 0.14
218 0.11
219 0.1
220 0.09
221 0.07
222 0.07
223 0.13
224 0.14
225 0.15
226 0.16
227 0.16
228 0.19
229 0.2
230 0.21
231 0.16
232 0.19
233 0.2
234 0.21
235 0.21
236 0.18
237 0.17
238 0.16
239 0.15
240 0.1
241 0.08
242 0.08
243 0.08
244 0.1
245 0.1
246 0.11
247 0.1
248 0.11
249 0.12
250 0.11
251 0.11
252 0.09
253 0.1
254 0.08
255 0.08
256 0.07
257 0.07
258 0.12
259 0.19
260 0.2
261 0.23
262 0.29
263 0.36
264 0.44
265 0.54
266 0.6
267 0.63
268 0.73
269 0.76
270 0.8
271 0.8
272 0.75
273 0.73
274 0.68
275 0.63
276 0.53
277 0.45
278 0.36
279 0.29
280 0.25
281 0.17
282 0.11
283 0.06
284 0.05
285 0.05
286 0.05
287 0.05
288 0.04
289 0.04
290 0.05
291 0.05
292 0.05
293 0.05
294 0.08
295 0.09
296 0.1
297 0.13
298 0.12
299 0.13
300 0.15
301 0.17
302 0.18
303 0.17
304 0.19
305 0.19
306 0.19
307 0.18
308 0.16
309 0.15
310 0.12
311 0.12
312 0.1
313 0.08
314 0.12
315 0.16
316 0.18
317 0.2
318 0.21
319 0.25
320 0.26