Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A218YTX3

Protein Details
Accession A0A218YTX3   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-38LLLQHKRRSRIGRSKYVRHEKSQRKHPVABasic
NLS Segment(s)
PositionSequence
15-33KRRSRIGRSKYVRHEKSQR
Subcellular Location(s) mito 19.5, cyto_mito 12, cyto 3.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021463  Methyltransf_34  
Pfam View protein in Pfam  
PF11312  Methyltransf_34  
Amino Acid Sequences MAVRDPGFVLLLQHKRRSRIGRSKYVRHEKSQRKHPVASSATSLLRAPTVPAAPRDSLPLIIDTADEAVAERDDVGQEKREQDWEEEEEKKCAVQTLLDMEFWEKHVAGPERVSAWEELVRNWSRLFKSEAGLKFPIRLENIKLQVHLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.57
4 0.63
5 0.65
6 0.67
7 0.7
8 0.73
9 0.77
10 0.82
11 0.84
12 0.87
13 0.81
14 0.79
15 0.81
16 0.81
17 0.82
18 0.83
19 0.83
20 0.78
21 0.77
22 0.7
23 0.69
24 0.62
25 0.54
26 0.47
27 0.4
28 0.34
29 0.3
30 0.28
31 0.18
32 0.16
33 0.14
34 0.11
35 0.1
36 0.12
37 0.12
38 0.14
39 0.17
40 0.17
41 0.18
42 0.2
43 0.18
44 0.16
45 0.15
46 0.14
47 0.11
48 0.1
49 0.09
50 0.07
51 0.06
52 0.05
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.03
60 0.04
61 0.05
62 0.06
63 0.08
64 0.1
65 0.11
66 0.12
67 0.15
68 0.16
69 0.16
70 0.18
71 0.2
72 0.22
73 0.25
74 0.25
75 0.23
76 0.22
77 0.21
78 0.18
79 0.15
80 0.12
81 0.08
82 0.08
83 0.12
84 0.13
85 0.13
86 0.13
87 0.13
88 0.13
89 0.14
90 0.14
91 0.1
92 0.09
93 0.16
94 0.18
95 0.19
96 0.19
97 0.19
98 0.2
99 0.2
100 0.21
101 0.15
102 0.14
103 0.17
104 0.16
105 0.16
106 0.22
107 0.23
108 0.23
109 0.24
110 0.27
111 0.25
112 0.27
113 0.32
114 0.27
115 0.29
116 0.36
117 0.37
118 0.37
119 0.39
120 0.37
121 0.35
122 0.34
123 0.36
124 0.32
125 0.33
126 0.33
127 0.38
128 0.44
129 0.42