Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A218YXM5

Protein Details
Accession A0A218YXM5    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
65-89AWTPRIPSPSRRRPKPPPSLASRLRHydrophilic
NLS Segment(s)
PositionSequence
43-83GGKSRRRPWITTRPPPSPPHGAAWTPRIPSPSRRRPKPPPS
Subcellular Location(s) nucl 11, mito 6, extr 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MREENISLASRDGRPTRELGQADAAVARLAATPPIGAGWERLGGKSRRRPWITTRPPPSPPHGAAWTPRIPSPSRRRPKPPPSLASRLRWASLVSRAAGRDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.32
4 0.36
5 0.35
6 0.31
7 0.32
8 0.29
9 0.27
10 0.24
11 0.2
12 0.12
13 0.11
14 0.09
15 0.05
16 0.05
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.06
26 0.09
27 0.09
28 0.1
29 0.15
30 0.18
31 0.26
32 0.34
33 0.39
34 0.46
35 0.49
36 0.52
37 0.55
38 0.63
39 0.65
40 0.66
41 0.65
42 0.61
43 0.63
44 0.62
45 0.59
46 0.54
47 0.46
48 0.4
49 0.37
50 0.34
51 0.32
52 0.35
53 0.33
54 0.28
55 0.28
56 0.27
57 0.26
58 0.34
59 0.42
60 0.47
61 0.54
62 0.61
63 0.69
64 0.77
65 0.85
66 0.86
67 0.85
68 0.83
69 0.81
70 0.82
71 0.8
72 0.75
73 0.72
74 0.64
75 0.55
76 0.48
77 0.41
78 0.36
79 0.36
80 0.33
81 0.27
82 0.27