Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A218ZF61

Protein Details
Accession A0A218ZF61    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MPKAEPKTKRAAKVKPEKKKKDPNAPKRGLSABasic
NLS Segment(s)
PositionSequence
5-28EPKTKRAAKVKPEKKKKDPNAPKR
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKAEPKTKRAAKVKPEKKKKDPNAPKRGLSAYMFFANEQRENVREENPGITFGQVGKVLGERWKALNDKQRTPYEAKAAQDKKRYEDEKASYNADAEEEESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.88
4 0.89
5 0.9
6 0.92
7 0.91
8 0.91
9 0.92
10 0.92
11 0.92
12 0.88
13 0.8
14 0.73
15 0.66
16 0.58
17 0.48
18 0.39
19 0.31
20 0.27
21 0.24
22 0.2
23 0.2
24 0.19
25 0.18
26 0.17
27 0.15
28 0.14
29 0.17
30 0.19
31 0.18
32 0.17
33 0.17
34 0.17
35 0.16
36 0.16
37 0.13
38 0.11
39 0.1
40 0.08
41 0.09
42 0.07
43 0.07
44 0.06
45 0.07
46 0.07
47 0.1
48 0.11
49 0.11
50 0.12
51 0.15
52 0.18
53 0.22
54 0.31
55 0.34
56 0.4
57 0.46
58 0.48
59 0.49
60 0.51
61 0.49
62 0.48
63 0.46
64 0.42
65 0.45
66 0.49
67 0.51
68 0.55
69 0.54
70 0.51
71 0.57
72 0.57
73 0.53
74 0.55
75 0.52
76 0.51
77 0.53
78 0.51
79 0.42
80 0.4
81 0.34
82 0.26
83 0.22