Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A218Z5T9

Protein Details
Accession A0A218Z5T9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
92-116FELGTRPVPKKQRRKTEKTKSQALRHydrophilic
NLS Segment(s)
PositionSequence
100-112PKKQRRKTEKTKS
Subcellular Location(s) nucl 18.5, cyto_nucl 12, mito 6
Family & Domain DBs
Amino Acid Sequences MTSSHPTSLLPLTNPSRHVPLQGKLQVAASEQIQNASFPSSLPRPQRPMGEPPTDSRIRALTECLPRKRLLDGLDSPFSLATLSGLPTKDDFELGTRPVPKKQRRKTEKTKSQALR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.37
4 0.35
5 0.4
6 0.38
7 0.36
8 0.42
9 0.43
10 0.42
11 0.37
12 0.37
13 0.31
14 0.27
15 0.24
16 0.16
17 0.15
18 0.14
19 0.15
20 0.14
21 0.13
22 0.12
23 0.13
24 0.11
25 0.08
26 0.12
27 0.14
28 0.19
29 0.25
30 0.29
31 0.33
32 0.35
33 0.4
34 0.4
35 0.44
36 0.44
37 0.43
38 0.39
39 0.36
40 0.4
41 0.36
42 0.33
43 0.26
44 0.22
45 0.18
46 0.18
47 0.18
48 0.17
49 0.25
50 0.33
51 0.34
52 0.35
53 0.35
54 0.36
55 0.35
56 0.32
57 0.26
58 0.24
59 0.26
60 0.29
61 0.29
62 0.28
63 0.27
64 0.23
65 0.21
66 0.15
67 0.1
68 0.06
69 0.05
70 0.06
71 0.09
72 0.09
73 0.1
74 0.11
75 0.13
76 0.12
77 0.12
78 0.12
79 0.12
80 0.15
81 0.16
82 0.2
83 0.25
84 0.27
85 0.34
86 0.44
87 0.51
88 0.6
89 0.68
90 0.74
91 0.79
92 0.87
93 0.91
94 0.92
95 0.92
96 0.9