Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A218YUQ9

Protein Details
Accession A0A218YUQ9   
Localization Confidence High
Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
165-185GEPKLGTKKKRKIDTNPEGSAHydrophilic
225-261KVTEEKPDKDSKQRKKLKKKERRLRRKFKEQEATKVVBasic
NLS Segment(s)
PositionSequence
129-156KGRSSLGRAKKLNSHRKAETVKQPKKRA
168-176KLGTKKKRK
232-253DKDSKQRKKLKKKERRLRRKFK
Subcellular Location(s) nucl 17, mito 7, cyto 2
Family & Domain DBs
Amino Acid Sequences MALKEPTKIAKVTKEDPTVILNRLAVAMAKREAMISSWETSSSWSKPRKTQEELDAEDAILFRNEPPHLGVGAPLPAEFLVSEAERSNKSLRAKIFPTKGFKASKARDAQEKAASEKQGMRVESSDEEKGRSSLGRAKKLNSHRKAETVKQPKKRASDSDVSEEGEPKLGTKKKRKIDTNPEGSAEQFGLDTPSKDSEYDQEGLSDFAEPKLEAITALGQESAGKVTEEKPDKDSKQRKKLKKKERRLRRKFKEQEATKVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.49
3 0.48
4 0.49
5 0.44
6 0.39
7 0.35
8 0.27
9 0.22
10 0.21
11 0.2
12 0.16
13 0.14
14 0.15
15 0.14
16 0.14
17 0.14
18 0.14
19 0.14
20 0.13
21 0.16
22 0.15
23 0.16
24 0.16
25 0.16
26 0.16
27 0.19
28 0.23
29 0.23
30 0.28
31 0.34
32 0.38
33 0.45
34 0.55
35 0.6
36 0.61
37 0.64
38 0.65
39 0.66
40 0.65
41 0.61
42 0.51
43 0.43
44 0.37
45 0.3
46 0.21
47 0.13
48 0.1
49 0.06
50 0.1
51 0.1
52 0.1
53 0.12
54 0.13
55 0.13
56 0.13
57 0.13
58 0.1
59 0.12
60 0.11
61 0.09
62 0.08
63 0.07
64 0.07
65 0.06
66 0.06
67 0.06
68 0.06
69 0.07
70 0.08
71 0.1
72 0.11
73 0.13
74 0.15
75 0.18
76 0.21
77 0.25
78 0.27
79 0.31
80 0.35
81 0.4
82 0.44
83 0.45
84 0.48
85 0.47
86 0.5
87 0.47
88 0.47
89 0.49
90 0.45
91 0.47
92 0.46
93 0.45
94 0.46
95 0.47
96 0.46
97 0.42
98 0.41
99 0.37
100 0.34
101 0.32
102 0.27
103 0.26
104 0.27
105 0.26
106 0.25
107 0.22
108 0.19
109 0.2
110 0.2
111 0.21
112 0.18
113 0.14
114 0.15
115 0.14
116 0.14
117 0.13
118 0.11
119 0.1
120 0.15
121 0.21
122 0.28
123 0.29
124 0.31
125 0.38
126 0.48
127 0.57
128 0.56
129 0.56
130 0.5
131 0.55
132 0.58
133 0.56
134 0.56
135 0.57
136 0.6
137 0.63
138 0.68
139 0.67
140 0.68
141 0.66
142 0.61
143 0.57
144 0.56
145 0.5
146 0.49
147 0.45
148 0.4
149 0.36
150 0.32
151 0.25
152 0.2
153 0.16
154 0.11
155 0.17
156 0.2
157 0.29
158 0.38
159 0.47
160 0.53
161 0.63
162 0.7
163 0.73
164 0.8
165 0.82
166 0.8
167 0.74
168 0.67
169 0.59
170 0.51
171 0.41
172 0.3
173 0.2
174 0.11
175 0.09
176 0.1
177 0.1
178 0.1
179 0.11
180 0.13
181 0.14
182 0.15
183 0.16
184 0.16
185 0.2
186 0.2
187 0.18
188 0.17
189 0.16
190 0.16
191 0.16
192 0.14
193 0.1
194 0.09
195 0.1
196 0.09
197 0.09
198 0.1
199 0.09
200 0.07
201 0.08
202 0.09
203 0.09
204 0.09
205 0.09
206 0.08
207 0.08
208 0.09
209 0.09
210 0.07
211 0.07
212 0.08
213 0.11
214 0.2
215 0.26
216 0.28
217 0.32
218 0.4
219 0.45
220 0.54
221 0.63
222 0.65
223 0.7
224 0.78
225 0.84
226 0.87
227 0.93
228 0.93
229 0.94
230 0.94
231 0.95
232 0.96
233 0.96
234 0.96
235 0.97
236 0.96
237 0.96
238 0.94
239 0.94
240 0.94
241 0.89