Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0WQ53

Protein Details
Accession J0WQ53    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
18-44ISTVRLAPQRGRRRRRRNRDVDANGILHydrophilic
NLS Segment(s)
PositionSequence
26-35QRGRRRRRRN
Subcellular Location(s) nucl 15, cyto_nucl 13, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR029047  HSP70_peptide-bd_sf  
IPR013126  Hsp_70_fam  
Gene Ontology GO:0005524  F:ATP binding  
GO:0140662  F:ATP-dependent protein folding chaperone  
KEGG adl:AURDEDRAFT_40421  -  
Pfam View protein in Pfam  
PF00012  HSP70  
Amino Acid Sequences EDKGERTKDNNIHAKFSISTVRLAPQRGRRRRRRNRDVDANGILNVAAANKTASPSNSNHITNANDEGRLSQEAIGGMVAEEYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.41
3 0.37
4 0.34
5 0.25
6 0.25
7 0.21
8 0.26
9 0.25
10 0.28
11 0.32
12 0.36
13 0.46
14 0.54
15 0.64
16 0.7
17 0.78
18 0.87
19 0.92
20 0.93
21 0.92
22 0.91
23 0.92
24 0.86
25 0.8
26 0.72
27 0.61
28 0.5
29 0.39
30 0.29
31 0.18
32 0.13
33 0.07
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.06
40 0.08
41 0.1
42 0.12
43 0.17
44 0.22
45 0.23
46 0.23
47 0.25
48 0.26
49 0.24
50 0.28
51 0.24
52 0.2
53 0.19
54 0.19
55 0.19
56 0.18
57 0.17
58 0.12
59 0.13
60 0.13
61 0.13
62 0.12
63 0.09
64 0.08