Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A218Z9C4

Protein Details
Accession A0A218Z9C4   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
99-118TSTPASATWCRRRRRTGGRAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, extr 6, nucl 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
IPR002347  SDR_fam  
Pfam View protein in Pfam  
PF13561  adh_short_C2  
Amino Acid Sequences MPSCLCRYLGILGKSVAAWNEVIPTDLTGTFHCAKAVGAHFQARGRGSFVTTASMSGHIANFPQEQTSYNVAKAGCIHMARSLAHEWRGFASTPSARATSTPASATWCRRRRRTGGRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.18
4 0.12
5 0.11
6 0.09
7 0.11
8 0.1
9 0.11
10 0.1
11 0.1
12 0.1
13 0.1
14 0.11
15 0.1
16 0.15
17 0.15
18 0.15
19 0.15
20 0.13
21 0.13
22 0.16
23 0.18
24 0.15
25 0.16
26 0.17
27 0.19
28 0.2
29 0.23
30 0.19
31 0.18
32 0.16
33 0.15
34 0.14
35 0.14
36 0.13
37 0.13
38 0.12
39 0.12
40 0.1
41 0.11
42 0.1
43 0.09
44 0.08
45 0.06
46 0.06
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.08
53 0.12
54 0.16
55 0.16
56 0.15
57 0.18
58 0.17
59 0.17
60 0.17
61 0.15
62 0.13
63 0.12
64 0.13
65 0.12
66 0.14
67 0.14
68 0.16
69 0.17
70 0.17
71 0.2
72 0.2
73 0.19
74 0.19
75 0.21
76 0.18
77 0.16
78 0.2
79 0.18
80 0.2
81 0.22
82 0.21
83 0.2
84 0.2
85 0.24
86 0.21
87 0.21
88 0.2
89 0.18
90 0.24
91 0.29
92 0.37
93 0.43
94 0.48
95 0.55
96 0.63
97 0.71
98 0.76