Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A218Z2R2

Protein Details
Accession A0A218Z2R2   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MTHQVCTASRHRTKRCRRPSTRLREEANFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, nucl 11, cyto_mito 8.5
Family & Domain DBs
Amino Acid Sequences MTHQVCTASRHRTKRCRRPSTRLREEANFHAGIAGHQRGFLPTSRRFVQPTSSDASAQGPGQVMSASPNANSSGHGHGHVHAQAQPENPHAPTTIMPGQDLPIIPGAIATNLETRDKLRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.89
3 0.9
4 0.9
5 0.91
6 0.92
7 0.93
8 0.92
9 0.89
10 0.83
11 0.78
12 0.73
13 0.67
14 0.61
15 0.5
16 0.39
17 0.32
18 0.26
19 0.21
20 0.21
21 0.18
22 0.12
23 0.13
24 0.13
25 0.13
26 0.14
27 0.17
28 0.18
29 0.2
30 0.25
31 0.27
32 0.29
33 0.3
34 0.3
35 0.33
36 0.29
37 0.28
38 0.27
39 0.25
40 0.23
41 0.22
42 0.22
43 0.17
44 0.14
45 0.12
46 0.08
47 0.07
48 0.07
49 0.07
50 0.05
51 0.06
52 0.07
53 0.07
54 0.07
55 0.07
56 0.09
57 0.09
58 0.1
59 0.11
60 0.13
61 0.13
62 0.15
63 0.14
64 0.14
65 0.17
66 0.17
67 0.15
68 0.15
69 0.16
70 0.17
71 0.2
72 0.21
73 0.21
74 0.22
75 0.21
76 0.2
77 0.19
78 0.18
79 0.15
80 0.2
81 0.21
82 0.19
83 0.19
84 0.19
85 0.19
86 0.2
87 0.19
88 0.14
89 0.12
90 0.12
91 0.11
92 0.11
93 0.1
94 0.09
95 0.09
96 0.1
97 0.11
98 0.13
99 0.15
100 0.15