Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A218Z7M4

Protein Details
Accession A0A218Z7M4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
72-134KASLAKPKAKAKPKSKSKSKSKSKAKPKPKPKPKPKPKPKPKPKPKPKPKPPRKSATHRSKTPBasic
NLS Segment(s)
PositionSequence
75-137LAKPKAKAKPKSKSKSKSKSKAKPKPKPKPKPKPKPKPKPKPKPKPKPPRKSATHRSKTPPSS
Subcellular Location(s) mito 19, nucl 7
Family & Domain DBs
Amino Acid Sequences MPSRGLVARARLGAHARRRFGFPVSSDPLRSTVAGVVSGMDSAPRRELSLAWILHLAADDLLCCTCTVLQPKASLAKPKAKAKPKSKSKSKSKSKAKPKPKPKPKPKPKPKPKPKPKPKPKPPRKSATHRSKTPPSSTLPLRRRTFWRRHGSSLASSAAVFFQESACAPSCHPESLVPGHAEGPGDNGLLLCARESRWRDAADASRDDLMRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.48
4 0.49
5 0.52
6 0.51
7 0.49
8 0.46
9 0.39
10 0.4
11 0.42
12 0.42
13 0.39
14 0.38
15 0.37
16 0.33
17 0.3
18 0.22
19 0.18
20 0.16
21 0.15
22 0.13
23 0.11
24 0.1
25 0.09
26 0.08
27 0.08
28 0.08
29 0.09
30 0.12
31 0.12
32 0.12
33 0.13
34 0.14
35 0.16
36 0.22
37 0.21
38 0.19
39 0.19
40 0.18
41 0.17
42 0.17
43 0.13
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.09
54 0.14
55 0.16
56 0.18
57 0.19
58 0.21
59 0.26
60 0.28
61 0.31
62 0.31
63 0.37
64 0.41
65 0.49
66 0.56
67 0.59
68 0.67
69 0.7
70 0.76
71 0.79
72 0.82
73 0.84
74 0.86
75 0.87
76 0.89
77 0.9
78 0.9
79 0.89
80 0.89
81 0.9
82 0.9
83 0.9
84 0.9
85 0.9
86 0.91
87 0.91
88 0.93
89 0.93
90 0.94
91 0.94
92 0.95
93 0.95
94 0.96
95 0.96
96 0.96
97 0.96
98 0.96
99 0.96
100 0.96
101 0.96
102 0.96
103 0.96
104 0.96
105 0.96
106 0.96
107 0.95
108 0.95
109 0.92
110 0.91
111 0.88
112 0.87
113 0.86
114 0.86
115 0.84
116 0.8
117 0.79
118 0.77
119 0.74
120 0.68
121 0.6
122 0.53
123 0.5
124 0.5
125 0.53
126 0.51
127 0.55
128 0.54
129 0.54
130 0.59
131 0.62
132 0.65
133 0.65
134 0.69
135 0.65
136 0.68
137 0.69
138 0.64
139 0.57
140 0.51
141 0.42
142 0.31
143 0.26
144 0.21
145 0.16
146 0.12
147 0.1
148 0.07
149 0.06
150 0.06
151 0.07
152 0.09
153 0.11
154 0.11
155 0.11
156 0.17
157 0.19
158 0.19
159 0.19
160 0.18
161 0.2
162 0.24
163 0.27
164 0.23
165 0.21
166 0.21
167 0.21
168 0.2
169 0.16
170 0.15
171 0.12
172 0.11
173 0.1
174 0.09
175 0.09
176 0.09
177 0.1
178 0.07
179 0.08
180 0.1
181 0.18
182 0.22
183 0.28
184 0.33
185 0.34
186 0.35
187 0.41
188 0.47
189 0.46
190 0.45
191 0.41
192 0.39