Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A218Z1I1

Protein Details
Accession A0A218Z1I1    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
59-78LERLKRRRLELRSRRLEQEKBasic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, cyto_nucl 9, cyto 7.5, cysk 6, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MGGPNLEVFKFGMYIMFPIAFMYYYGINLDERFAVPGFWPKPEQTNRIPFEKEEIHNELERLKRRRLELRSRRLEQEKEGASDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.08
6 0.08
7 0.07
8 0.07
9 0.08
10 0.07
11 0.07
12 0.07
13 0.08
14 0.08
15 0.08
16 0.08
17 0.07
18 0.07
19 0.08
20 0.08
21 0.07
22 0.08
23 0.14
24 0.14
25 0.16
26 0.17
27 0.16
28 0.24
29 0.27
30 0.31
31 0.3
32 0.38
33 0.39
34 0.41
35 0.42
36 0.35
37 0.36
38 0.37
39 0.33
40 0.29
41 0.3
42 0.29
43 0.28
44 0.29
45 0.29
46 0.3
47 0.37
48 0.36
49 0.39
50 0.41
51 0.46
52 0.55
53 0.6
54 0.65
55 0.67
56 0.74
57 0.77
58 0.77
59 0.8
60 0.78
61 0.73
62 0.67
63 0.66
64 0.58