Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0WN39

Protein Details
Accession J0WN39   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MSDSDRHHARPPKQPKPPETKKPSEILHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 11, cyto 7, mito 5
Family & Domain DBs
KEGG adl:AURDEDRAFT_177671  -  
Amino Acid Sequences MSDSDRHHARPPKQPKPPETKKPSEILVLDSTQKGWAHRNAVNQCRALSHDVLHSVTNFCQAVRDITLTAPSHELYLSDEAPLKRLSADLKTLGQWVQTALEAYAARRATSLAPAPAPNPPTTQPPKTPATRSTQPTPSPSPAPAVTTSAKVPASTKTPQSSSTSKTKSAPPPVPAPTPSEPTLLPTPRTTPKRDIPATSRLFVRYRDAPDPQCRPHPKTIVRTLNNCFEDPVLRAVSYTRDNQLILHTILPFSAQHLIGYDKMLQDTIGPLLFPSATTPPVPTFDTGEAWSKVVLRGVPLPIWGTKSTVDRQLRALSSDLCASNNLSSSSVQLVRKIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.86
4 0.89
5 0.89
6 0.88
7 0.87
8 0.83
9 0.77
10 0.71
11 0.66
12 0.56
13 0.5
14 0.45
15 0.37
16 0.34
17 0.31
18 0.28
19 0.25
20 0.26
21 0.23
22 0.25
23 0.29
24 0.33
25 0.36
26 0.44
27 0.5
28 0.57
29 0.6
30 0.56
31 0.51
32 0.46
33 0.46
34 0.41
35 0.33
36 0.27
37 0.24
38 0.24
39 0.25
40 0.24
41 0.22
42 0.19
43 0.18
44 0.21
45 0.18
46 0.15
47 0.16
48 0.16
49 0.17
50 0.17
51 0.18
52 0.15
53 0.15
54 0.21
55 0.19
56 0.19
57 0.18
58 0.16
59 0.16
60 0.15
61 0.14
62 0.12
63 0.15
64 0.13
65 0.13
66 0.18
67 0.17
68 0.2
69 0.2
70 0.17
71 0.14
72 0.15
73 0.17
74 0.15
75 0.18
76 0.18
77 0.2
78 0.2
79 0.22
80 0.21
81 0.18
82 0.16
83 0.13
84 0.11
85 0.1
86 0.1
87 0.08
88 0.1
89 0.1
90 0.1
91 0.14
92 0.14
93 0.13
94 0.13
95 0.14
96 0.12
97 0.15
98 0.17
99 0.14
100 0.15
101 0.16
102 0.17
103 0.19
104 0.21
105 0.18
106 0.18
107 0.18
108 0.25
109 0.3
110 0.34
111 0.34
112 0.37
113 0.41
114 0.43
115 0.46
116 0.42
117 0.44
118 0.46
119 0.48
120 0.49
121 0.5
122 0.48
123 0.49
124 0.49
125 0.44
126 0.39
127 0.34
128 0.31
129 0.25
130 0.25
131 0.21
132 0.2
133 0.18
134 0.17
135 0.17
136 0.16
137 0.16
138 0.14
139 0.14
140 0.13
141 0.16
142 0.17
143 0.2
144 0.2
145 0.21
146 0.23
147 0.27
148 0.28
149 0.28
150 0.34
151 0.34
152 0.34
153 0.35
154 0.39
155 0.41
156 0.46
157 0.45
158 0.4
159 0.42
160 0.43
161 0.43
162 0.37
163 0.36
164 0.3
165 0.3
166 0.28
167 0.25
168 0.21
169 0.23
170 0.27
171 0.23
172 0.22
173 0.19
174 0.22
175 0.29
176 0.33
177 0.34
178 0.35
179 0.39
180 0.47
181 0.48
182 0.48
183 0.45
184 0.5
185 0.49
186 0.44
187 0.4
188 0.34
189 0.33
190 0.3
191 0.3
192 0.26
193 0.28
194 0.3
195 0.33
196 0.36
197 0.42
198 0.47
199 0.45
200 0.49
201 0.52
202 0.53
203 0.56
204 0.59
205 0.58
206 0.6
207 0.67
208 0.68
209 0.65
210 0.66
211 0.62
212 0.62
213 0.57
214 0.49
215 0.4
216 0.3
217 0.28
218 0.23
219 0.22
220 0.15
221 0.13
222 0.12
223 0.13
224 0.16
225 0.17
226 0.18
227 0.17
228 0.18
229 0.18
230 0.19
231 0.2
232 0.2
233 0.18
234 0.17
235 0.15
236 0.14
237 0.13
238 0.14
239 0.11
240 0.1
241 0.12
242 0.11
243 0.1
244 0.12
245 0.14
246 0.13
247 0.15
248 0.15
249 0.13
250 0.13
251 0.13
252 0.12
253 0.1
254 0.11
255 0.11
256 0.09
257 0.08
258 0.07
259 0.08
260 0.08
261 0.08
262 0.09
263 0.1
264 0.12
265 0.12
266 0.15
267 0.15
268 0.19
269 0.2
270 0.19
271 0.2
272 0.2
273 0.22
274 0.22
275 0.25
276 0.23
277 0.22
278 0.22
279 0.19
280 0.19
281 0.19
282 0.17
283 0.15
284 0.18
285 0.2
286 0.19
287 0.2
288 0.21
289 0.2
290 0.23
291 0.21
292 0.2
293 0.21
294 0.25
295 0.28
296 0.36
297 0.39
298 0.37
299 0.41
300 0.45
301 0.44
302 0.41
303 0.4
304 0.31
305 0.29
306 0.31
307 0.28
308 0.22
309 0.22
310 0.21
311 0.2
312 0.21
313 0.2
314 0.17
315 0.17
316 0.18
317 0.22
318 0.26
319 0.26