Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0LGF7

Protein Details
Accession J0LGF7   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
223-247LQPPVPKKAKSKTPKYRLKYGWKATHydrophilic
NLS Segment(s)
PositionSequence
16-37PSHKVRATRKAAAERGPPAPPK
229-237KKAKSKTPK
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 2, pero 2
Family & Domain DBs
KEGG adl:AURDEDRAFT_174265  -  
Amino Acid Sequences MRTKKASKSPGAEDAPSHKVRATRKAAAERGPPAPPKARFCKTCHGPMRGHNKSECALSKNSPAALDAKVAECEEVALAAHTDYVSRRIDEVVALVLEASDGDADTAAIMAAITDAGLAIPEGKTLADFVPSVPGIDSDDEDEEGAGESRRGSPDVSRDSTPADSGDAAGGVEGLSTPPATPGPDERATGDIGDGLHADPPVESMDIDNAPAPPASAPNTLPLQPPVPKKAKSKTPKYRLKYGWKATPSGILPMELARNGLKRQEYPTQAEKAKRIPRMFQAMAQKGDTLASRTNGWAFCVFMPRGGAGLMRTWHSQQIESDVPGLLSEVRHLVFEKLQPFREQYLKSLEESNKKAQEELEFWKARAAKSEQEAAALRKKYGVSDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.52
3 0.46
4 0.41
5 0.34
6 0.36
7 0.4
8 0.47
9 0.49
10 0.49
11 0.56
12 0.64
13 0.68
14 0.69
15 0.69
16 0.64
17 0.6
18 0.58
19 0.53
20 0.5
21 0.53
22 0.52
23 0.54
24 0.58
25 0.63
26 0.63
27 0.65
28 0.7
29 0.68
30 0.73
31 0.73
32 0.7
33 0.66
34 0.69
35 0.74
36 0.7
37 0.69
38 0.6
39 0.55
40 0.51
41 0.52
42 0.47
43 0.4
44 0.37
45 0.35
46 0.39
47 0.38
48 0.38
49 0.32
50 0.29
51 0.27
52 0.23
53 0.22
54 0.18
55 0.16
56 0.16
57 0.16
58 0.14
59 0.11
60 0.11
61 0.08
62 0.07
63 0.06
64 0.05
65 0.05
66 0.05
67 0.06
68 0.05
69 0.06
70 0.07
71 0.11
72 0.12
73 0.13
74 0.14
75 0.14
76 0.15
77 0.14
78 0.14
79 0.11
80 0.09
81 0.08
82 0.07
83 0.06
84 0.05
85 0.05
86 0.04
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.03
107 0.03
108 0.03
109 0.04
110 0.04
111 0.04
112 0.06
113 0.06
114 0.06
115 0.07
116 0.07
117 0.1
118 0.1
119 0.11
120 0.09
121 0.09
122 0.09
123 0.1
124 0.1
125 0.08
126 0.09
127 0.09
128 0.09
129 0.08
130 0.07
131 0.06
132 0.07
133 0.05
134 0.05
135 0.06
136 0.07
137 0.08
138 0.09
139 0.09
140 0.11
141 0.18
142 0.23
143 0.26
144 0.25
145 0.25
146 0.26
147 0.26
148 0.25
149 0.18
150 0.13
151 0.1
152 0.09
153 0.08
154 0.06
155 0.05
156 0.04
157 0.04
158 0.03
159 0.03
160 0.02
161 0.02
162 0.03
163 0.03
164 0.03
165 0.04
166 0.04
167 0.05
168 0.06
169 0.08
170 0.13
171 0.15
172 0.15
173 0.16
174 0.16
175 0.16
176 0.16
177 0.13
178 0.09
179 0.07
180 0.07
181 0.06
182 0.05
183 0.06
184 0.05
185 0.06
186 0.04
187 0.05
188 0.06
189 0.05
190 0.05
191 0.05
192 0.06
193 0.06
194 0.07
195 0.07
196 0.06
197 0.07
198 0.06
199 0.07
200 0.05
201 0.06
202 0.09
203 0.1
204 0.1
205 0.13
206 0.15
207 0.16
208 0.16
209 0.17
210 0.17
211 0.2
212 0.23
213 0.28
214 0.32
215 0.36
216 0.42
217 0.47
218 0.55
219 0.59
220 0.67
221 0.71
222 0.75
223 0.8
224 0.79
225 0.82
226 0.81
227 0.82
228 0.8
229 0.76
230 0.73
231 0.65
232 0.62
233 0.53
234 0.49
235 0.39
236 0.33
237 0.27
238 0.19
239 0.17
240 0.16
241 0.16
242 0.11
243 0.12
244 0.1
245 0.12
246 0.13
247 0.16
248 0.17
249 0.19
250 0.24
251 0.3
252 0.33
253 0.36
254 0.41
255 0.44
256 0.46
257 0.48
258 0.47
259 0.48
260 0.51
261 0.53
262 0.51
263 0.49
264 0.5
265 0.55
266 0.52
267 0.49
268 0.51
269 0.48
270 0.48
271 0.44
272 0.38
273 0.29
274 0.29
275 0.24
276 0.17
277 0.15
278 0.14
279 0.15
280 0.16
281 0.19
282 0.18
283 0.2
284 0.18
285 0.17
286 0.16
287 0.21
288 0.2
289 0.18
290 0.19
291 0.16
292 0.16
293 0.15
294 0.14
295 0.09
296 0.12
297 0.13
298 0.14
299 0.16
300 0.17
301 0.22
302 0.22
303 0.23
304 0.21
305 0.26
306 0.26
307 0.25
308 0.24
309 0.2
310 0.18
311 0.16
312 0.16
313 0.11
314 0.08
315 0.09
316 0.1
317 0.1
318 0.11
319 0.12
320 0.14
321 0.16
322 0.21
323 0.27
324 0.3
325 0.33
326 0.35
327 0.38
328 0.4
329 0.44
330 0.41
331 0.38
332 0.41
333 0.41
334 0.39
335 0.44
336 0.46
337 0.47
338 0.51
339 0.56
340 0.54
341 0.52
342 0.52
343 0.46
344 0.45
345 0.41
346 0.42
347 0.43
348 0.39
349 0.38
350 0.43
351 0.43
352 0.38
353 0.41
354 0.39
355 0.36
356 0.39
357 0.46
358 0.41
359 0.42
360 0.45
361 0.43
362 0.46
363 0.42
364 0.37
365 0.34
366 0.34