Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A218YTI5

Protein Details
Accession A0A218YTI5    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
2-30NGYTATPHHRQNRRRERPGSRTRRTITRKBasic
NLS Segment(s)
PositionSequence
13-25NRRRERPGSRTRR
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MNGYTATPHHRQNRRRERPGSRTRRTITRKAGVTCDLQEELRDARDADYYLPSDKSRPSPLLRQNFNQSWQRWQARKAEEIALAEMDMMQLEKEQLMRFGGELGDDVSLIPAMLDVVVSLFGDVDYIDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.86
4 0.87
5 0.88
6 0.91
7 0.91
8 0.87
9 0.86
10 0.8
11 0.81
12 0.79
13 0.77
14 0.75
15 0.72
16 0.7
17 0.63
18 0.62
19 0.55
20 0.5
21 0.41
22 0.35
23 0.29
24 0.22
25 0.2
26 0.18
27 0.16
28 0.14
29 0.13
30 0.11
31 0.1
32 0.11
33 0.12
34 0.11
35 0.12
36 0.12
37 0.13
38 0.14
39 0.14
40 0.14
41 0.16
42 0.18
43 0.19
44 0.22
45 0.24
46 0.31
47 0.39
48 0.46
49 0.47
50 0.46
51 0.49
52 0.47
53 0.48
54 0.46
55 0.39
56 0.36
57 0.4
58 0.44
59 0.4
60 0.42
61 0.45
62 0.42
63 0.43
64 0.4
65 0.35
66 0.3
67 0.29
68 0.26
69 0.18
70 0.15
71 0.12
72 0.1
73 0.06
74 0.05
75 0.04
76 0.03
77 0.03
78 0.04
79 0.04
80 0.06
81 0.06
82 0.08
83 0.09
84 0.09
85 0.09
86 0.09
87 0.09
88 0.07
89 0.08
90 0.07
91 0.06
92 0.06
93 0.06
94 0.05
95 0.05
96 0.05
97 0.04
98 0.04
99 0.04
100 0.03
101 0.03
102 0.03
103 0.03
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04