Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A218Z022

Protein Details
Accession A0A218Z022    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPANTGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
8-23AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 11, mito_nucl 10.333, cyto_nucl 9.833, mito 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPANTGAKKQKKKWSKGKVKDKAQHAVILDKATSDKLQKDVQSYRLVTVAVLVDRLKINGSLARRCLADLEEKGQIKKVVGHSKLQIYTRAITAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.89
4 0.9
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.48
15 0.39
16 0.32
17 0.25
18 0.18
19 0.16
20 0.14
21 0.14
22 0.13
23 0.12
24 0.15
25 0.18
26 0.19
27 0.24
28 0.25
29 0.28
30 0.3
31 0.29
32 0.27
33 0.24
34 0.22
35 0.17
36 0.15
37 0.12
38 0.07
39 0.07
40 0.06
41 0.07
42 0.07
43 0.08
44 0.07
45 0.07
46 0.08
47 0.1
48 0.14
49 0.16
50 0.18
51 0.19
52 0.19
53 0.19
54 0.19
55 0.17
56 0.2
57 0.18
58 0.2
59 0.25
60 0.26
61 0.27
62 0.29
63 0.29
64 0.23
65 0.27
66 0.33
67 0.36
68 0.37
69 0.42
70 0.43
71 0.49
72 0.53
73 0.49
74 0.46
75 0.4
76 0.39