Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A218Z2T6

Protein Details
Accession A0A218Z2T6    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
117-140EDKGDWGKKARKRQRDVEKKIAERBasic
NLS Segment(s)
PositionSequence
98-105KGKGKGSG
122-136WGKKARKRQRDVEKK
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 6, cyto 2.5, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MSDPLSRFLAGALDFLQWLVSLPRQGYTNLTRNSVEMWDGMTPFKYIRLIAILGGYLFLRPYLQKWGERTQAKQHEKEFSSPGQQAVLSANELRDGGKGKGKGSGKSVKFQEEEGEEDKGDWGKKARKRQRDVEKKIAEREEERLMDKEDIDIMEHLVDYEEGKDGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.07
5 0.08
6 0.09
7 0.1
8 0.12
9 0.12
10 0.14
11 0.15
12 0.16
13 0.21
14 0.26
15 0.33
16 0.33
17 0.35
18 0.34
19 0.33
20 0.34
21 0.3
22 0.23
23 0.14
24 0.14
25 0.12
26 0.12
27 0.12
28 0.11
29 0.11
30 0.1
31 0.12
32 0.11
33 0.1
34 0.1
35 0.11
36 0.11
37 0.11
38 0.11
39 0.09
40 0.08
41 0.08
42 0.07
43 0.05
44 0.05
45 0.04
46 0.05
47 0.05
48 0.07
49 0.14
50 0.17
51 0.2
52 0.25
53 0.3
54 0.37
55 0.4
56 0.41
57 0.43
58 0.51
59 0.53
60 0.53
61 0.5
62 0.49
63 0.48
64 0.47
65 0.41
66 0.32
67 0.31
68 0.27
69 0.25
70 0.18
71 0.16
72 0.14
73 0.12
74 0.11
75 0.08
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.09
83 0.1
84 0.14
85 0.15
86 0.15
87 0.22
88 0.24
89 0.25
90 0.28
91 0.36
92 0.33
93 0.38
94 0.4
95 0.38
96 0.37
97 0.35
98 0.33
99 0.25
100 0.27
101 0.23
102 0.22
103 0.17
104 0.17
105 0.17
106 0.17
107 0.15
108 0.13
109 0.18
110 0.24
111 0.32
112 0.43
113 0.52
114 0.6
115 0.67
116 0.76
117 0.81
118 0.84
119 0.86
120 0.86
121 0.85
122 0.8
123 0.79
124 0.73
125 0.66
126 0.57
127 0.53
128 0.49
129 0.42
130 0.39
131 0.35
132 0.34
133 0.31
134 0.29
135 0.25
136 0.2
137 0.18
138 0.17
139 0.15
140 0.12
141 0.11
142 0.11
143 0.1
144 0.09
145 0.09
146 0.08
147 0.08