Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0CU06

Protein Details
Accession J0CU06    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
97-127FCDARGINPKRKLREPRPRRRQPAARRVHQPBasic
NLS Segment(s)
PositionSequence
104-125NPKRKLREPRPRRRQPAARRVH
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, cyto 3.5, mito 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
KEGG adl:AURDEDRAFT_31992  -  
Amino Acid Sequences AAYILELPPELVKRKLHPTFHVSLLREYVESDDSKFPDRRLDDVLSLGEETFEKTVNEIVGYQWADGKPVFLVNWSDGLTTQEHYQTVVHLQAFDEFCDARGINPKRKLREPRPRRRQPAARRVHQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.45
3 0.48
4 0.5
5 0.54
6 0.53
7 0.57
8 0.58
9 0.5
10 0.44
11 0.41
12 0.37
13 0.29
14 0.26
15 0.21
16 0.17
17 0.16
18 0.17
19 0.18
20 0.18
21 0.24
22 0.25
23 0.23
24 0.28
25 0.29
26 0.29
27 0.3
28 0.31
29 0.26
30 0.26
31 0.25
32 0.19
33 0.17
34 0.14
35 0.1
36 0.07
37 0.07
38 0.06
39 0.07
40 0.06
41 0.06
42 0.07
43 0.07
44 0.07
45 0.06
46 0.06
47 0.09
48 0.09
49 0.08
50 0.09
51 0.09
52 0.1
53 0.1
54 0.1
55 0.07
56 0.07
57 0.07
58 0.06
59 0.08
60 0.07
61 0.09
62 0.09
63 0.09
64 0.09
65 0.1
66 0.1
67 0.1
68 0.11
69 0.1
70 0.1
71 0.11
72 0.11
73 0.1
74 0.11
75 0.13
76 0.12
77 0.1
78 0.11
79 0.14
80 0.15
81 0.14
82 0.15
83 0.12
84 0.12
85 0.15
86 0.14
87 0.12
88 0.21
89 0.27
90 0.34
91 0.44
92 0.5
93 0.55
94 0.64
95 0.74
96 0.75
97 0.8
98 0.82
99 0.85
100 0.89
101 0.93
102 0.93
103 0.93
104 0.93
105 0.92
106 0.92
107 0.91