Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A218YSH6

Protein Details
Accession A0A218YSH6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAITSPFKAKIKRRYHPKREIDLEDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
IPR012132  GMC_OxRdtase  
IPR007867  GMC_OxRtase_C  
Gene Ontology GO:0050660  F:flavin adenine dinucleotide binding  
GO:0016614  F:oxidoreductase activity, acting on CH-OH group of donors  
Pfam View protein in Pfam  
PF05199  GMC_oxred_C  
Amino Acid Sequences MAITSPFKAKIKRRYHPKREIDLEDSKQVENYLRGSIATQNNPLGLVSVGTPGVGAVDGRLKVRGTKGLRVVDASVNPLYVSGNTVATVHALAEKGADSIKEDWDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.87
3 0.9
4 0.9
5 0.89
6 0.86
7 0.82
8 0.78
9 0.74
10 0.67
11 0.62
12 0.54
13 0.44
14 0.37
15 0.31
16 0.27
17 0.2
18 0.18
19 0.14
20 0.12
21 0.12
22 0.13
23 0.18
24 0.21
25 0.21
26 0.21
27 0.2
28 0.2
29 0.2
30 0.19
31 0.13
32 0.08
33 0.07
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.04
40 0.04
41 0.03
42 0.03
43 0.03
44 0.05
45 0.06
46 0.06
47 0.08
48 0.08
49 0.1
50 0.11
51 0.19
52 0.2
53 0.25
54 0.31
55 0.32
56 0.32
57 0.32
58 0.33
59 0.27
60 0.25
61 0.23
62 0.17
63 0.14
64 0.13
65 0.12
66 0.11
67 0.09
68 0.1
69 0.08
70 0.08
71 0.08
72 0.09
73 0.09
74 0.09
75 0.09
76 0.07
77 0.08
78 0.07
79 0.07
80 0.07
81 0.08
82 0.08
83 0.09
84 0.09
85 0.1
86 0.12