Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A218ZAV7

Protein Details
Accession A0A218ZAV7    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
148-168ESIIKHTVKCRYCRKRISDKVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 23, nucl 1, mito 1, E.R. 1, golg 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR037673  MSC/AndL  
IPR036019  MscL_channel  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01741  MscL  
Amino Acid Sequences MPRPRIRLEDSSELLQHAGEEAGRRVNKIWHSFTDWALQDNILEVAVGLIVAAAFTSVVTSFVSDILLPPLSLLPFINRNMDEKFAVLKRGPGYNKTDGIGYNTLSQAADDGAVVLAYGTFFNKIINFIGVGLALYFIASVYDTVSTESIIKHTVKCRYCRKRISDKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.28
3 0.21
4 0.13
5 0.1
6 0.08
7 0.09
8 0.1
9 0.17
10 0.18
11 0.19
12 0.2
13 0.25
14 0.32
15 0.36
16 0.39
17 0.36
18 0.42
19 0.43
20 0.43
21 0.44
22 0.37
23 0.32
24 0.28
25 0.25
26 0.18
27 0.17
28 0.15
29 0.08
30 0.07
31 0.05
32 0.04
33 0.04
34 0.04
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.03
45 0.04
46 0.04
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.09
63 0.1
64 0.13
65 0.13
66 0.15
67 0.15
68 0.17
69 0.15
70 0.13
71 0.15
72 0.13
73 0.15
74 0.13
75 0.15
76 0.15
77 0.2
78 0.21
79 0.21
80 0.26
81 0.28
82 0.29
83 0.26
84 0.26
85 0.21
86 0.24
87 0.21
88 0.16
89 0.14
90 0.13
91 0.13
92 0.12
93 0.12
94 0.08
95 0.07
96 0.06
97 0.04
98 0.04
99 0.04
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.04
107 0.04
108 0.05
109 0.06
110 0.06
111 0.08
112 0.09
113 0.09
114 0.09
115 0.08
116 0.09
117 0.08
118 0.07
119 0.06
120 0.05
121 0.04
122 0.04
123 0.03
124 0.03
125 0.03
126 0.04
127 0.04
128 0.04
129 0.05
130 0.06
131 0.07
132 0.08
133 0.08
134 0.09
135 0.1
136 0.11
137 0.14
138 0.16
139 0.19
140 0.26
141 0.34
142 0.4
143 0.49
144 0.59
145 0.66
146 0.74
147 0.79
148 0.82