Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A218YX87

Protein Details
Accession A0A218YX87    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
149-170SSVGTKVRRWWYKTNNWKMPKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013898  Atg43  
Gene Ontology GO:0140580  F:mitochondrion autophagosome adaptor activity  
GO:0000423  P:mitophagy  
Pfam View protein in Pfam  
PF08589  ATG43  
Amino Acid Sequences MSSSLPIEIASTIQSASIKRDPSPTHDLNPSTAASQRQPVSLSRSDQSLDKYAYDSEGIDGSEVEEEEEEDVPYSVLEPVPRRHSFGPLPDLRFEQSYLTSIRHAESNWGVAFITLRDQLVLPLVQGMLWTLALSGWRYWNRTAELSGSSVGTKVRRWWYKTNNWKMPKSMRDFGGNAKLASDIGDYYQNQSSSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.17
4 0.22
5 0.23
6 0.24
7 0.32
8 0.33
9 0.39
10 0.47
11 0.44
12 0.44
13 0.48
14 0.48
15 0.42
16 0.42
17 0.36
18 0.28
19 0.28
20 0.26
21 0.21
22 0.26
23 0.25
24 0.24
25 0.25
26 0.26
27 0.29
28 0.3
29 0.32
30 0.27
31 0.27
32 0.27
33 0.27
34 0.28
35 0.27
36 0.23
37 0.21
38 0.21
39 0.19
40 0.19
41 0.18
42 0.14
43 0.1
44 0.1
45 0.09
46 0.08
47 0.07
48 0.07
49 0.06
50 0.06
51 0.05
52 0.04
53 0.05
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.05
61 0.06
62 0.05
63 0.05
64 0.08
65 0.1
66 0.14
67 0.21
68 0.22
69 0.25
70 0.25
71 0.29
72 0.29
73 0.31
74 0.35
75 0.32
76 0.33
77 0.31
78 0.32
79 0.28
80 0.26
81 0.22
82 0.15
83 0.12
84 0.11
85 0.11
86 0.11
87 0.11
88 0.11
89 0.11
90 0.11
91 0.1
92 0.11
93 0.11
94 0.12
95 0.12
96 0.11
97 0.11
98 0.1
99 0.1
100 0.07
101 0.09
102 0.07
103 0.07
104 0.07
105 0.07
106 0.07
107 0.08
108 0.08
109 0.06
110 0.06
111 0.06
112 0.05
113 0.05
114 0.05
115 0.04
116 0.04
117 0.04
118 0.03
119 0.04
120 0.05
121 0.06
122 0.07
123 0.12
124 0.15
125 0.18
126 0.19
127 0.23
128 0.25
129 0.26
130 0.26
131 0.22
132 0.22
133 0.21
134 0.19
135 0.16
136 0.14
137 0.13
138 0.14
139 0.14
140 0.14
141 0.19
142 0.28
143 0.35
144 0.41
145 0.51
146 0.58
147 0.67
148 0.76
149 0.81
150 0.81
151 0.82
152 0.8
153 0.78
154 0.77
155 0.76
156 0.73
157 0.68
158 0.61
159 0.59
160 0.56
161 0.55
162 0.55
163 0.48
164 0.4
165 0.34
166 0.31
167 0.25
168 0.25
169 0.19
170 0.11
171 0.1
172 0.15
173 0.15
174 0.19
175 0.24