Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A218Z1Y7

Protein Details
Accession A0A218Z1Y7    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
174-200EIERRFRIIKFRNKYHRIKNKLIDEMRHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 8, nucl 7, golg 4, mito_nucl 4, extr 3
Family & Domain DBs
Amino Acid Sequences MHFSKILILVIIAPGVLGMTFKGNTLDRKDIAAKKKNPHPTPTPPSPPPNPEITDWRDKPWSHYDIKASVADNVFPVDMGKDRQVEIDHKDIITPSLPSDVKIPRPFLPTKDKKVKDLYVESLAAYVTENEKTQEQKSKELSQKWVDVKNFNDKTLCYYSTSSFHLRCSNKQDEIERRFRIIKFRNKYHRIKNKLIDEMRVEGLVNLGRDLTEYMEKTGQTIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.04
6 0.06
7 0.07
8 0.08
9 0.11
10 0.14
11 0.2
12 0.26
13 0.3
14 0.29
15 0.33
16 0.4
17 0.45
18 0.52
19 0.57
20 0.58
21 0.62
22 0.7
23 0.77
24 0.74
25 0.74
26 0.72
27 0.72
28 0.74
29 0.74
30 0.73
31 0.68
32 0.7
33 0.69
34 0.65
35 0.58
36 0.55
37 0.48
38 0.43
39 0.44
40 0.43
41 0.47
42 0.44
43 0.44
44 0.45
45 0.42
46 0.45
47 0.45
48 0.45
49 0.38
50 0.4
51 0.4
52 0.36
53 0.38
54 0.35
55 0.28
56 0.26
57 0.23
58 0.19
59 0.16
60 0.14
61 0.12
62 0.09
63 0.09
64 0.06
65 0.07
66 0.09
67 0.1
68 0.11
69 0.11
70 0.13
71 0.15
72 0.16
73 0.19
74 0.21
75 0.19
76 0.18
77 0.18
78 0.17
79 0.16
80 0.14
81 0.11
82 0.07
83 0.11
84 0.11
85 0.12
86 0.15
87 0.17
88 0.23
89 0.25
90 0.28
91 0.25
92 0.3
93 0.31
94 0.32
95 0.4
96 0.4
97 0.46
98 0.54
99 0.52
100 0.52
101 0.56
102 0.55
103 0.49
104 0.45
105 0.39
106 0.32
107 0.31
108 0.27
109 0.21
110 0.18
111 0.13
112 0.1
113 0.07
114 0.06
115 0.06
116 0.07
117 0.07
118 0.09
119 0.12
120 0.14
121 0.22
122 0.23
123 0.28
124 0.33
125 0.4
126 0.45
127 0.47
128 0.5
129 0.46
130 0.51
131 0.49
132 0.51
133 0.45
134 0.43
135 0.42
136 0.46
137 0.44
138 0.39
139 0.35
140 0.29
141 0.33
142 0.33
143 0.31
144 0.23
145 0.24
146 0.25
147 0.26
148 0.3
149 0.29
150 0.26
151 0.27
152 0.33
153 0.34
154 0.38
155 0.43
156 0.46
157 0.45
158 0.48
159 0.54
160 0.55
161 0.6
162 0.63
163 0.57
164 0.55
165 0.55
166 0.53
167 0.55
168 0.54
169 0.57
170 0.58
171 0.66
172 0.73
173 0.77
174 0.84
175 0.85
176 0.86
177 0.84
178 0.85
179 0.83
180 0.81
181 0.82
182 0.75
183 0.69
184 0.62
185 0.57
186 0.49
187 0.4
188 0.32
189 0.22
190 0.21
191 0.19
192 0.15
193 0.12
194 0.11
195 0.1
196 0.11
197 0.12
198 0.13
199 0.16
200 0.17
201 0.2
202 0.23
203 0.23