Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A218Z1I6

Protein Details
Accession A0A218Z1I6   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
16-90EVSSAPKSRKFKFKDKDRSRRRSEKHETRSRSPAERSRRDKDRRDRSRDRERHHRHHHHRKRRKHSPVNDDPALYBasic
NLS Segment(s)
PositionSequence
21-80PKSRKFKFKDKDRSRRRSEKHETRSRSPAERSRRDKDRRDRSRDRERHHRHHHHRKRRKH
212-222LKRGQERKSRK
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038753  NFKBIL1  
Gene Ontology GO:0007249  P:I-kappaB kinase/NF-kappaB signaling  
Amino Acid Sequences MGSNAGDESVLGEGNEVSSAPKSRKFKFKDKDRSRRRSEKHETRSRSPAERSRRDKDRRDRSRDRERHHRHHHHRKRRKHSPVNDDPALYDDTYLPNASSEQYVNPDVAFRESLFDAMADDEGAQFWEGVYGQPIHNYPDVKSGPDGELERMTDEEYAAFVRGKMYEKTHQHLIEEKARRDAAKKAQERLAQEIAREEREADGFRRKVEDSLKRGQERKSRKAWGDKWDAYIQQWEFLGKGAAAGRIHIASIPWPVESGKQTDSTDSGEVERFFLNAPTSGQPTEAQLVKVLKGERVRWHPDKIQQKLGGQGVGEDVVQAVTAVFQIIDRLWSDVRSAGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.07
5 0.1
6 0.15
7 0.18
8 0.26
9 0.33
10 0.4
11 0.5
12 0.56
13 0.64
14 0.7
15 0.78
16 0.81
17 0.86
18 0.9
19 0.91
20 0.94
21 0.93
22 0.94
23 0.9
24 0.89
25 0.89
26 0.89
27 0.89
28 0.89
29 0.87
30 0.83
31 0.85
32 0.8
33 0.76
34 0.73
35 0.71
36 0.71
37 0.74
38 0.75
39 0.74
40 0.79
41 0.81
42 0.83
43 0.85
44 0.86
45 0.86
46 0.88
47 0.9
48 0.89
49 0.91
50 0.9
51 0.87
52 0.87
53 0.86
54 0.87
55 0.88
56 0.89
57 0.89
58 0.91
59 0.94
60 0.94
61 0.95
62 0.95
63 0.94
64 0.94
65 0.94
66 0.93
67 0.92
68 0.91
69 0.91
70 0.89
71 0.8
72 0.69
73 0.58
74 0.5
75 0.42
76 0.31
77 0.21
78 0.13
79 0.12
80 0.13
81 0.13
82 0.1
83 0.09
84 0.09
85 0.1
86 0.1
87 0.1
88 0.1
89 0.13
90 0.13
91 0.13
92 0.13
93 0.13
94 0.12
95 0.13
96 0.12
97 0.09
98 0.11
99 0.11
100 0.11
101 0.1
102 0.09
103 0.08
104 0.07
105 0.07
106 0.05
107 0.05
108 0.04
109 0.04
110 0.05
111 0.05
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.06
118 0.07
119 0.07
120 0.09
121 0.1
122 0.12
123 0.14
124 0.15
125 0.14
126 0.2
127 0.21
128 0.2
129 0.2
130 0.19
131 0.17
132 0.19
133 0.19
134 0.13
135 0.13
136 0.13
137 0.12
138 0.11
139 0.11
140 0.09
141 0.08
142 0.06
143 0.05
144 0.06
145 0.06
146 0.06
147 0.05
148 0.06
149 0.07
150 0.1
151 0.11
152 0.14
153 0.21
154 0.24
155 0.27
156 0.32
157 0.31
158 0.3
159 0.33
160 0.34
161 0.35
162 0.37
163 0.34
164 0.33
165 0.33
166 0.33
167 0.3
168 0.32
169 0.32
170 0.37
171 0.4
172 0.4
173 0.45
174 0.48
175 0.48
176 0.47
177 0.44
178 0.34
179 0.31
180 0.31
181 0.27
182 0.25
183 0.23
184 0.18
185 0.13
186 0.14
187 0.16
188 0.14
189 0.2
190 0.2
191 0.21
192 0.23
193 0.23
194 0.25
195 0.32
196 0.37
197 0.35
198 0.43
199 0.5
200 0.52
201 0.55
202 0.58
203 0.59
204 0.6
205 0.62
206 0.62
207 0.62
208 0.63
209 0.7
210 0.69
211 0.69
212 0.69
213 0.64
214 0.6
215 0.56
216 0.51
217 0.41
218 0.41
219 0.32
220 0.24
221 0.22
222 0.18
223 0.15
224 0.14
225 0.14
226 0.07
227 0.08
228 0.08
229 0.11
230 0.1
231 0.11
232 0.11
233 0.11
234 0.11
235 0.1
236 0.09
237 0.07
238 0.1
239 0.11
240 0.09
241 0.1
242 0.11
243 0.14
244 0.16
245 0.18
246 0.17
247 0.2
248 0.21
249 0.22
250 0.23
251 0.22
252 0.21
253 0.19
254 0.18
255 0.17
256 0.17
257 0.17
258 0.16
259 0.13
260 0.13
261 0.14
262 0.13
263 0.12
264 0.14
265 0.15
266 0.18
267 0.18
268 0.19
269 0.17
270 0.19
271 0.22
272 0.21
273 0.19
274 0.2
275 0.22
276 0.21
277 0.25
278 0.24
279 0.24
280 0.28
281 0.33
282 0.37
283 0.43
284 0.51
285 0.52
286 0.58
287 0.6
288 0.64
289 0.69
290 0.67
291 0.68
292 0.64
293 0.61
294 0.61
295 0.56
296 0.49
297 0.39
298 0.33
299 0.25
300 0.2
301 0.18
302 0.11
303 0.08
304 0.06
305 0.06
306 0.06
307 0.04
308 0.04
309 0.04
310 0.04
311 0.04
312 0.04
313 0.06
314 0.06
315 0.09
316 0.09
317 0.13
318 0.13
319 0.14
320 0.16