Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0WT71

Protein Details
Accession J0WT71   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-51APSPQEPRASRRRWRRRQQQISRAARQARHydrophilic
NLS Segment(s)
PositionSequence
30-39RASRRRWRRR
Subcellular Location(s) mito 18, cyto_nucl 5, nucl 4.5, cyto 4.5
Family & Domain DBs
KEGG adl:AURDEDRAFT_175526  -  
Amino Acid Sequences MHVKAVHRADYKRRTTPSFSTPAPSPQEPRASRRRWRRRQQQISRAARQARVPDAVPDAAGLVLAAAASSIWPVQLAPVLVPPASVAAARRAGLLAPHIAAVVRARAEQPEPAPPGATPDPGGTRATLNPFDALEDPFATPYSKTPFPFYAAGREERHNTPCNPVCNQVAGTISTCRRTSRATY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.67
3 0.67
4 0.64
5 0.61
6 0.55
7 0.51
8 0.48
9 0.49
10 0.48
11 0.45
12 0.42
13 0.41
14 0.49
15 0.48
16 0.53
17 0.56
18 0.58
19 0.64
20 0.71
21 0.76
22 0.77
23 0.85
24 0.89
25 0.9
26 0.93
27 0.95
28 0.94
29 0.93
30 0.91
31 0.87
32 0.83
33 0.75
34 0.67
35 0.59
36 0.53
37 0.46
38 0.39
39 0.33
40 0.27
41 0.26
42 0.23
43 0.19
44 0.15
45 0.12
46 0.09
47 0.08
48 0.06
49 0.03
50 0.03
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.03
60 0.03
61 0.03
62 0.04
63 0.04
64 0.04
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.05
71 0.05
72 0.05
73 0.05
74 0.07
75 0.08
76 0.08
77 0.09
78 0.08
79 0.08
80 0.08
81 0.08
82 0.06
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.06
90 0.06
91 0.06
92 0.06
93 0.08
94 0.09
95 0.11
96 0.11
97 0.16
98 0.18
99 0.17
100 0.18
101 0.16
102 0.21
103 0.2
104 0.2
105 0.15
106 0.14
107 0.16
108 0.17
109 0.18
110 0.13
111 0.13
112 0.14
113 0.18
114 0.18
115 0.17
116 0.16
117 0.15
118 0.16
119 0.16
120 0.15
121 0.12
122 0.12
123 0.11
124 0.11
125 0.12
126 0.11
127 0.1
128 0.13
129 0.18
130 0.21
131 0.22
132 0.26
133 0.27
134 0.31
135 0.34
136 0.32
137 0.35
138 0.34
139 0.38
140 0.37
141 0.39
142 0.4
143 0.41
144 0.45
145 0.43
146 0.4
147 0.45
148 0.47
149 0.48
150 0.47
151 0.46
152 0.43
153 0.4
154 0.39
155 0.32
156 0.28
157 0.25
158 0.24
159 0.25
160 0.26
161 0.28
162 0.29
163 0.29
164 0.3