Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A218YT08

Protein Details
Accession A0A218YT08    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
110-129ADKLKNKLFKKKVVEKPAAGHydrophilic
NLS Segment(s)
PositionSequence
113-121LKNKLFKKK
Subcellular Location(s) cyto 15.5, cyto_nucl 12.5, nucl 6.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MSAKSSVEVSHGRGGAGNIGPDTTSYTDGEIVREGYVGDHGDGAFSTGRGGVANIGSPGLPATKRKDDIAIPDVALRPSAEDQDFHTGRGGGGNVHKKDAVAPKHPIGFADKLKNKLFKKKVVEKPAAGAAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.21
4 0.18
5 0.13
6 0.13
7 0.12
8 0.11
9 0.14
10 0.12
11 0.13
12 0.12
13 0.13
14 0.16
15 0.16
16 0.17
17 0.14
18 0.14
19 0.12
20 0.11
21 0.1
22 0.07
23 0.09
24 0.08
25 0.07
26 0.07
27 0.07
28 0.07
29 0.06
30 0.08
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.09
49 0.14
50 0.18
51 0.19
52 0.2
53 0.22
54 0.22
55 0.26
56 0.26
57 0.22
58 0.18
59 0.18
60 0.18
61 0.16
62 0.15
63 0.1
64 0.09
65 0.09
66 0.11
67 0.1
68 0.09
69 0.12
70 0.2
71 0.2
72 0.19
73 0.19
74 0.17
75 0.17
76 0.18
77 0.16
78 0.09
79 0.16
80 0.24
81 0.23
82 0.25
83 0.25
84 0.24
85 0.29
86 0.35
87 0.35
88 0.32
89 0.37
90 0.39
91 0.42
92 0.43
93 0.38
94 0.35
95 0.35
96 0.35
97 0.4
98 0.42
99 0.45
100 0.5
101 0.58
102 0.58
103 0.64
104 0.65
105 0.64
106 0.69
107 0.73
108 0.78
109 0.79
110 0.82
111 0.73
112 0.7