Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0WPG3

Protein Details
Accession J0WPG3    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
203-228CRVWTRRSGAGPRRVRRKRGGGQEASHydrophilic
NLS Segment(s)
PositionSequence
209-222RSGAGPRRVRRKRG
Subcellular Location(s) nucl 13, cyto 9, mito 2, extr 2
Family & Domain DBs
KEGG adl:AURDEDRAFT_117685  -  
Amino Acid Sequences MPGLTAVDLEPHSALIASAFLPQEAAFAGAARDSVWYKAVIPDAIPPNPSQALPSSQVLQAEVEDYVHHRFSWAAPPIWLTPAGRVAEQGSGSVLLSLSREEDLEYVLRNGVFLFGRALRVRRFRDSGRPRPCSNCCSLEHSARACSQPTRCGLCSGGHLTSEHRCGECDFFDDAHEGLAHCGHTPLCCPHCAGSHAMCDSACRVWTRRSGAGPRRVRRKRGGGQEASAMDLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.06
3 0.07
4 0.06
5 0.09
6 0.09
7 0.09
8 0.09
9 0.09
10 0.09
11 0.09
12 0.09
13 0.06
14 0.06
15 0.07
16 0.06
17 0.06
18 0.06
19 0.08
20 0.08
21 0.09
22 0.1
23 0.11
24 0.12
25 0.14
26 0.16
27 0.15
28 0.14
29 0.2
30 0.23
31 0.24
32 0.25
33 0.22
34 0.24
35 0.25
36 0.24
37 0.19
38 0.16
39 0.19
40 0.21
41 0.22
42 0.2
43 0.2
44 0.2
45 0.19
46 0.17
47 0.14
48 0.11
49 0.1
50 0.08
51 0.07
52 0.09
53 0.1
54 0.11
55 0.1
56 0.1
57 0.1
58 0.12
59 0.19
60 0.21
61 0.2
62 0.19
63 0.22
64 0.22
65 0.23
66 0.23
67 0.15
68 0.12
69 0.16
70 0.17
71 0.14
72 0.14
73 0.14
74 0.14
75 0.14
76 0.12
77 0.08
78 0.08
79 0.07
80 0.07
81 0.06
82 0.04
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.06
91 0.06
92 0.07
93 0.06
94 0.07
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.07
102 0.07
103 0.09
104 0.1
105 0.13
106 0.15
107 0.22
108 0.25
109 0.28
110 0.32
111 0.32
112 0.42
113 0.5
114 0.56
115 0.59
116 0.61
117 0.59
118 0.62
119 0.64
120 0.57
121 0.52
122 0.46
123 0.39
124 0.41
125 0.42
126 0.38
127 0.38
128 0.35
129 0.32
130 0.3
131 0.29
132 0.24
133 0.24
134 0.22
135 0.23
136 0.26
137 0.29
138 0.28
139 0.28
140 0.28
141 0.25
142 0.27
143 0.26
144 0.22
145 0.18
146 0.18
147 0.18
148 0.2
149 0.22
150 0.2
151 0.17
152 0.17
153 0.18
154 0.2
155 0.18
156 0.19
157 0.17
158 0.15
159 0.16
160 0.17
161 0.15
162 0.13
163 0.13
164 0.09
165 0.08
166 0.09
167 0.08
168 0.07
169 0.08
170 0.08
171 0.08
172 0.11
173 0.18
174 0.19
175 0.2
176 0.21
177 0.22
178 0.26
179 0.27
180 0.28
181 0.24
182 0.27
183 0.27
184 0.27
185 0.24
186 0.22
187 0.22
188 0.2
189 0.19
190 0.17
191 0.2
192 0.24
193 0.31
194 0.36
195 0.4
196 0.45
197 0.53
198 0.6
199 0.67
200 0.72
201 0.74
202 0.79
203 0.82
204 0.83
205 0.82
206 0.84
207 0.83
208 0.84
209 0.85
210 0.8
211 0.74
212 0.73
213 0.63