Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J0WKY5

Protein Details
Accession J0WKY5    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKSKAKSKAARKKRASVVDSHydrophilic
NLS Segment(s)
PositionSequence
3-29SKAKSKAARKKRASVVDSSERRGMPRR
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8, cyto 3.5
Family & Domain DBs
KEGG adl:AURDEDRAFT_177969  -  
Amino Acid Sequences MKSKAKSKAARKKRASVVDSSERRGMPRRVRLIVREPERDPKELLGHEHAERNDHGLFTPPPLGGMPSSGESAQASPCPPATNVAGQHDPCGRGEDAAARPLPSTDLPILPEWTAGREGDVHGVAGENAARRSPPPPPSTEQHRSPAMATPVDINDSKRDTASPESAHGSDDQQPAGDRTSDGAGSSLSVVIQTSHGHGSGAGRCVAPSTSLLVLNLFVGPMAVQNGDSNQAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.8
3 0.76
4 0.73
5 0.73
6 0.69
7 0.64
8 0.6
9 0.5
10 0.5
11 0.51
12 0.51
13 0.5
14 0.55
15 0.58
16 0.59
17 0.63
18 0.66
19 0.68
20 0.69
21 0.66
22 0.63
23 0.58
24 0.62
25 0.61
26 0.57
27 0.49
28 0.43
29 0.41
30 0.36
31 0.37
32 0.32
33 0.32
34 0.32
35 0.35
36 0.32
37 0.3
38 0.28
39 0.28
40 0.23
41 0.2
42 0.18
43 0.17
44 0.17
45 0.17
46 0.19
47 0.15
48 0.15
49 0.15
50 0.15
51 0.11
52 0.11
53 0.11
54 0.1
55 0.11
56 0.1
57 0.1
58 0.1
59 0.11
60 0.1
61 0.1
62 0.1
63 0.09
64 0.1
65 0.11
66 0.11
67 0.12
68 0.13
69 0.16
70 0.17
71 0.2
72 0.23
73 0.22
74 0.24
75 0.24
76 0.23
77 0.19
78 0.21
79 0.17
80 0.13
81 0.14
82 0.16
83 0.15
84 0.17
85 0.17
86 0.14
87 0.14
88 0.14
89 0.15
90 0.1
91 0.11
92 0.1
93 0.1
94 0.11
95 0.12
96 0.13
97 0.11
98 0.12
99 0.09
100 0.09
101 0.09
102 0.08
103 0.07
104 0.07
105 0.07
106 0.08
107 0.08
108 0.06
109 0.05
110 0.06
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.07
119 0.09
120 0.14
121 0.2
122 0.22
123 0.26
124 0.3
125 0.35
126 0.43
127 0.48
128 0.46
129 0.44
130 0.43
131 0.4
132 0.37
133 0.36
134 0.3
135 0.23
136 0.2
137 0.17
138 0.15
139 0.17
140 0.17
141 0.14
142 0.15
143 0.17
144 0.17
145 0.16
146 0.16
147 0.17
148 0.2
149 0.23
150 0.21
151 0.21
152 0.24
153 0.23
154 0.24
155 0.21
156 0.2
157 0.22
158 0.22
159 0.2
160 0.18
161 0.18
162 0.19
163 0.19
164 0.17
165 0.11
166 0.11
167 0.12
168 0.12
169 0.11
170 0.1
171 0.09
172 0.09
173 0.09
174 0.07
175 0.06
176 0.05
177 0.05
178 0.06
179 0.07
180 0.07
181 0.09
182 0.1
183 0.1
184 0.1
185 0.11
186 0.14
187 0.17
188 0.18
189 0.17
190 0.16
191 0.16
192 0.18
193 0.17
194 0.15
195 0.12
196 0.13
197 0.14
198 0.15
199 0.15
200 0.14
201 0.14
202 0.13
203 0.12
204 0.09
205 0.06
206 0.06
207 0.05
208 0.06
209 0.07
210 0.07
211 0.07
212 0.09
213 0.1