Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A218ZI84

Protein Details
Accession A0A218ZI84   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
211-232ELETKGKGRKMRKVGCKKFDVIBasic
NLS Segment(s)
PositionSequence
219-219R
Subcellular Location(s) plas 22, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007512  Mic10  
Gene Ontology GO:0061617  C:MICOS complex  
Pfam View protein in Pfam  
PF04418  DUF543  
Amino Acid Sequences MPETSIPPPAAVARPSKPVSETLLNEKWDRCLSSLLIRSSLGLSFGVVFSVLLFKRRAWPAFVGLGFGAGRAYEESPCPQCLLIATIQFALKSLLLSTVAILLLHTLLTESQPPSTGIVLTVLAVLSSYFLFPNTRTNAHVFFQLLFLLILQLFLGKVLYEGWDWRWSGGFLVLGVFGLSGGAVVGVEIKRERGRGRSRMQVWLQGELDLELETKGKGRKMRKVGCKKFDVIEDRFLVFDGVKVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.36
4 0.35
5 0.34
6 0.37
7 0.38
8 0.38
9 0.39
10 0.42
11 0.43
12 0.44
13 0.43
14 0.4
15 0.37
16 0.35
17 0.28
18 0.26
19 0.25
20 0.3
21 0.36
22 0.33
23 0.32
24 0.3
25 0.29
26 0.27
27 0.25
28 0.18
29 0.11
30 0.1
31 0.09
32 0.08
33 0.08
34 0.06
35 0.06
36 0.05
37 0.1
38 0.1
39 0.12
40 0.13
41 0.14
42 0.21
43 0.27
44 0.28
45 0.27
46 0.29
47 0.3
48 0.34
49 0.33
50 0.27
51 0.21
52 0.21
53 0.17
54 0.15
55 0.11
56 0.06
57 0.06
58 0.06
59 0.07
60 0.07
61 0.09
62 0.12
63 0.15
64 0.15
65 0.16
66 0.14
67 0.13
68 0.13
69 0.14
70 0.12
71 0.11
72 0.11
73 0.11
74 0.12
75 0.11
76 0.11
77 0.09
78 0.08
79 0.07
80 0.06
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.05
87 0.05
88 0.05
89 0.04
90 0.04
91 0.04
92 0.03
93 0.03
94 0.03
95 0.04
96 0.06
97 0.06
98 0.06
99 0.07
100 0.08
101 0.09
102 0.09
103 0.08
104 0.07
105 0.07
106 0.07
107 0.06
108 0.05
109 0.04
110 0.04
111 0.04
112 0.03
113 0.03
114 0.03
115 0.04
116 0.03
117 0.04
118 0.05
119 0.06
120 0.12
121 0.14
122 0.15
123 0.17
124 0.19
125 0.21
126 0.21
127 0.22
128 0.17
129 0.15
130 0.14
131 0.13
132 0.11
133 0.08
134 0.07
135 0.06
136 0.05
137 0.04
138 0.04
139 0.04
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.05
147 0.05
148 0.06
149 0.09
150 0.12
151 0.12
152 0.12
153 0.13
154 0.12
155 0.12
156 0.12
157 0.1
158 0.07
159 0.07
160 0.07
161 0.06
162 0.05
163 0.05
164 0.03
165 0.03
166 0.03
167 0.02
168 0.02
169 0.02
170 0.02
171 0.02
172 0.05
173 0.05
174 0.07
175 0.07
176 0.11
177 0.13
178 0.17
179 0.2
180 0.27
181 0.36
182 0.43
183 0.49
184 0.56
185 0.57
186 0.63
187 0.63
188 0.61
189 0.54
190 0.51
191 0.45
192 0.36
193 0.33
194 0.24
195 0.22
196 0.14
197 0.13
198 0.08
199 0.08
200 0.07
201 0.11
202 0.14
203 0.19
204 0.26
205 0.34
206 0.43
207 0.53
208 0.63
209 0.7
210 0.79
211 0.84
212 0.86
213 0.84
214 0.78
215 0.71
216 0.7
217 0.67
218 0.59
219 0.56
220 0.5
221 0.44
222 0.41
223 0.37
224 0.29
225 0.21