Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A218Z5S2

Protein Details
Accession A0A218Z5S2    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
319-340AEENRLKREKEEKRRRLTAMAKBasic
NLS Segment(s)
PositionSequence
198-215KPGGKVRAAPEPEKKMKK
323-345RLKREKEEKRRRLTAMAKAKSRR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013256  Chromatin_SPT2  
Amino Acid Sequences MPPISDLLAQISGEPSDTQPTYTTPPAPKRKADEQIRKSIDKIQRIGAAAANSSRPMALSGKPPTVETSIAKMKLGQNGQSRAVARPSTSTTAFQNGHPTPPPSNDAPKAAPKKGSFAEIMARGKAAQSTLGQVGKIQHKRIEKMPSKRERDDLKAQKSSNLQKNLASDSKFSKMGQANVRNGQSAKDNGKMGQDGAKPGGKVRAAPEPEKKMKKAATATTGYTGTSRPKPAGAASKTSGSASSSRYNRGLDRDRYRGERYGARYAYPSEEEEEEDDEEEEERSYDSDLSDMEAAAFEVDDEEEEATRIARREDAEALAEENRLKREKEEKRRRLTAMAKAKSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.16
4 0.16
5 0.17
6 0.17
7 0.2
8 0.25
9 0.28
10 0.33
11 0.36
12 0.46
13 0.55
14 0.6
15 0.64
16 0.66
17 0.71
18 0.75
19 0.77
20 0.78
21 0.75
22 0.8
23 0.79
24 0.74
25 0.66
26 0.65
27 0.62
28 0.58
29 0.53
30 0.47
31 0.46
32 0.45
33 0.45
34 0.39
35 0.32
36 0.26
37 0.25
38 0.21
39 0.17
40 0.16
41 0.14
42 0.11
43 0.12
44 0.14
45 0.15
46 0.21
47 0.25
48 0.29
49 0.29
50 0.3
51 0.31
52 0.3
53 0.3
54 0.24
55 0.26
56 0.29
57 0.29
58 0.28
59 0.29
60 0.3
61 0.34
62 0.35
63 0.35
64 0.36
65 0.39
66 0.41
67 0.41
68 0.4
69 0.35
70 0.37
71 0.31
72 0.24
73 0.24
74 0.26
75 0.26
76 0.26
77 0.25
78 0.23
79 0.29
80 0.29
81 0.27
82 0.31
83 0.28
84 0.3
85 0.31
86 0.32
87 0.27
88 0.29
89 0.32
90 0.27
91 0.32
92 0.31
93 0.33
94 0.33
95 0.4
96 0.43
97 0.42
98 0.44
99 0.38
100 0.41
101 0.38
102 0.38
103 0.29
104 0.25
105 0.26
106 0.26
107 0.27
108 0.22
109 0.21
110 0.18
111 0.17
112 0.17
113 0.12
114 0.08
115 0.08
116 0.1
117 0.13
118 0.13
119 0.13
120 0.13
121 0.18
122 0.24
123 0.28
124 0.28
125 0.3
126 0.33
127 0.36
128 0.41
129 0.47
130 0.47
131 0.52
132 0.6
133 0.65
134 0.68
135 0.68
136 0.69
137 0.63
138 0.62
139 0.63
140 0.61
141 0.59
142 0.58
143 0.56
144 0.53
145 0.54
146 0.56
147 0.53
148 0.49
149 0.43
150 0.39
151 0.4
152 0.4
153 0.37
154 0.29
155 0.24
156 0.21
157 0.23
158 0.22
159 0.2
160 0.22
161 0.21
162 0.26
163 0.32
164 0.35
165 0.36
166 0.39
167 0.4
168 0.34
169 0.32
170 0.28
171 0.23
172 0.21
173 0.2
174 0.2
175 0.2
176 0.19
177 0.21
178 0.2
179 0.18
180 0.2
181 0.18
182 0.16
183 0.18
184 0.18
185 0.17
186 0.17
187 0.21
188 0.16
189 0.16
190 0.17
191 0.22
192 0.24
193 0.29
194 0.35
195 0.39
196 0.47
197 0.5
198 0.49
199 0.48
200 0.47
201 0.48
202 0.46
203 0.42
204 0.4
205 0.38
206 0.38
207 0.34
208 0.32
209 0.26
210 0.22
211 0.19
212 0.18
213 0.2
214 0.2
215 0.19
216 0.19
217 0.2
218 0.23
219 0.31
220 0.28
221 0.3
222 0.29
223 0.31
224 0.3
225 0.3
226 0.26
227 0.19
228 0.19
229 0.17
230 0.23
231 0.24
232 0.27
233 0.29
234 0.31
235 0.31
236 0.37
237 0.42
238 0.44
239 0.48
240 0.52
241 0.54
242 0.57
243 0.59
244 0.55
245 0.51
246 0.48
247 0.47
248 0.49
249 0.46
250 0.42
251 0.39
252 0.37
253 0.36
254 0.31
255 0.27
256 0.21
257 0.21
258 0.21
259 0.2
260 0.2
261 0.17
262 0.15
263 0.14
264 0.12
265 0.12
266 0.11
267 0.09
268 0.08
269 0.07
270 0.07
271 0.08
272 0.08
273 0.08
274 0.08
275 0.08
276 0.1
277 0.1
278 0.09
279 0.08
280 0.08
281 0.07
282 0.07
283 0.06
284 0.04
285 0.04
286 0.05
287 0.05
288 0.05
289 0.06
290 0.06
291 0.07
292 0.07
293 0.07
294 0.1
295 0.11
296 0.12
297 0.15
298 0.16
299 0.2
300 0.22
301 0.23
302 0.23
303 0.23
304 0.23
305 0.21
306 0.21
307 0.21
308 0.21
309 0.24
310 0.25
311 0.26
312 0.3
313 0.4
314 0.49
315 0.58
316 0.66
317 0.71
318 0.78
319 0.85
320 0.83
321 0.82
322 0.79
323 0.78
324 0.77
325 0.76