Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A218Z904

Protein Details
Accession A0A218Z904    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
75-95KVNYNRKKDENGKYRKKRSADBasic
NLS Segment(s)
PositionSequence
81-93KKDENGKYRKKRS
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR022190  DUF3716  
Pfam View protein in Pfam  
PF12511  DUF3716  
Amino Acid Sequences MVQARGVEASTPCTRCSRHVGPFLTCKHMVPVRRSVVDTVIDKLFLNGACANCYFGRKGAQCSLRKAHEKQYGVKVNYNRKKDENGKYRKKRSADPSSKLRQNPLLRAGLFNTNINSATMVLRSSGGATVRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.4
4 0.42
5 0.43
6 0.5
7 0.52
8 0.53
9 0.59
10 0.58
11 0.56
12 0.49
13 0.41
14 0.39
15 0.39
16 0.4
17 0.36
18 0.42
19 0.4
20 0.42
21 0.42
22 0.37
23 0.36
24 0.34
25 0.3
26 0.25
27 0.2
28 0.18
29 0.17
30 0.16
31 0.15
32 0.11
33 0.12
34 0.11
35 0.11
36 0.12
37 0.12
38 0.14
39 0.13
40 0.14
41 0.13
42 0.12
43 0.17
44 0.17
45 0.21
46 0.25
47 0.32
48 0.34
49 0.38
50 0.41
51 0.41
52 0.45
53 0.43
54 0.46
55 0.45
56 0.45
57 0.44
58 0.49
59 0.52
60 0.48
61 0.51
62 0.48
63 0.52
64 0.57
65 0.57
66 0.51
67 0.46
68 0.52
69 0.56
70 0.6
71 0.6
72 0.63
73 0.7
74 0.77
75 0.83
76 0.83
77 0.78
78 0.76
79 0.76
80 0.77
81 0.75
82 0.72
83 0.72
84 0.74
85 0.77
86 0.7
87 0.65
88 0.62
89 0.58
90 0.57
91 0.54
92 0.5
93 0.44
94 0.44
95 0.42
96 0.38
97 0.35
98 0.31
99 0.26
100 0.22
101 0.22
102 0.21
103 0.19
104 0.14
105 0.13
106 0.12
107 0.11
108 0.1
109 0.1
110 0.1
111 0.1
112 0.12