Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J0WMN6

Protein Details
Accession J0WMN6    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
76-102DSCPVCKSARYDRRRRPLQTQLRNSDFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
KEGG adl:AURDEDRAFT_77226  -  
Amino Acid Sequences LSEQDMDILRAFAFKTENYISRKTYRNMPRYFRKLLLPSPGSSRTRLKSLSGVKPVLYDCCPRSCVLFVGQHAKLDSCPVCKSARYDRRRRPLQTQLRNSDFSNRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.15
3 0.18
4 0.25
5 0.28
6 0.32
7 0.35
8 0.39
9 0.45
10 0.41
11 0.48
12 0.52
13 0.57
14 0.6
15 0.65
16 0.69
17 0.7
18 0.72
19 0.65
20 0.61
21 0.56
22 0.52
23 0.52
24 0.44
25 0.38
26 0.38
27 0.42
28 0.37
29 0.36
30 0.38
31 0.31
32 0.32
33 0.32
34 0.29
35 0.29
36 0.35
37 0.37
38 0.37
39 0.36
40 0.32
41 0.32
42 0.31
43 0.26
44 0.21
45 0.19
46 0.16
47 0.18
48 0.19
49 0.18
50 0.19
51 0.18
52 0.17
53 0.18
54 0.19
55 0.19
56 0.24
57 0.25
58 0.24
59 0.23
60 0.22
61 0.19
62 0.2
63 0.2
64 0.17
65 0.18
66 0.19
67 0.21
68 0.22
69 0.28
70 0.34
71 0.42
72 0.49
73 0.59
74 0.67
75 0.76
76 0.83
77 0.84
78 0.82
79 0.83
80 0.84
81 0.84
82 0.84
83 0.83
84 0.79
85 0.76
86 0.68