Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0SD45

Protein Details
Accession A0A1X0SD45    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
42-66FIPMAPNQPKPPRKRRRPPFSYSSLHydrophilic
NLS Segment(s)
PositionSequence
51-59KPPRKRRRP
Subcellular Location(s) mito 18.5, mito_nucl 14, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001766  Fork_head_dom  
IPR018122  TF_fork_head_CS_1  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
Pfam View protein in Pfam  
PF00250  Forkhead  
PROSITE View protein in PROSITE  
PS00657  FORK_HEAD_1  
PS50039  FORK_HEAD_3  
Amino Acid Sequences MTNYLPPIPVLMRKPTLIASVKQYRSEAQGEQLHQHIVSESFIPMAPNQPKPPRKRRRPPFSYSSLIAQAILASENERMTLRDIYNWIINKYPALYNADDTGWQNTIRHNLSLNRCFKKVPKDELDEHKGKGGYWTIDPTYMEKFKNGAFARGASASMRKRPVSSPSSPCLPDTPVSISMPKENTKSTYNKPANEPCHVMQIHNLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.36
4 0.34
5 0.32
6 0.34
7 0.41
8 0.43
9 0.44
10 0.45
11 0.39
12 0.4
13 0.41
14 0.34
15 0.31
16 0.34
17 0.33
18 0.34
19 0.34
20 0.3
21 0.26
22 0.25
23 0.19
24 0.14
25 0.13
26 0.11
27 0.1
28 0.09
29 0.1
30 0.1
31 0.1
32 0.17
33 0.21
34 0.24
35 0.31
36 0.4
37 0.49
38 0.57
39 0.68
40 0.72
41 0.78
42 0.85
43 0.89
44 0.9
45 0.9
46 0.88
47 0.84
48 0.8
49 0.73
50 0.64
51 0.56
52 0.47
53 0.38
54 0.31
55 0.23
56 0.16
57 0.11
58 0.1
59 0.07
60 0.05
61 0.06
62 0.06
63 0.07
64 0.07
65 0.08
66 0.1
67 0.13
68 0.12
69 0.13
70 0.15
71 0.16
72 0.19
73 0.2
74 0.18
75 0.16
76 0.16
77 0.14
78 0.15
79 0.14
80 0.11
81 0.14
82 0.13
83 0.13
84 0.14
85 0.13
86 0.13
87 0.13
88 0.12
89 0.1
90 0.1
91 0.09
92 0.09
93 0.14
94 0.14
95 0.14
96 0.15
97 0.2
98 0.26
99 0.34
100 0.4
101 0.38
102 0.38
103 0.39
104 0.41
105 0.45
106 0.46
107 0.46
108 0.44
109 0.47
110 0.52
111 0.59
112 0.62
113 0.54
114 0.47
115 0.43
116 0.37
117 0.31
118 0.28
119 0.23
120 0.17
121 0.16
122 0.18
123 0.15
124 0.17
125 0.17
126 0.17
127 0.2
128 0.21
129 0.2
130 0.18
131 0.19
132 0.18
133 0.27
134 0.25
135 0.24
136 0.21
137 0.22
138 0.23
139 0.22
140 0.22
141 0.15
142 0.21
143 0.22
144 0.26
145 0.31
146 0.3
147 0.32
148 0.34
149 0.41
150 0.41
151 0.45
152 0.45
153 0.45
154 0.49
155 0.48
156 0.46
157 0.41
158 0.37
159 0.3
160 0.27
161 0.27
162 0.25
163 0.26
164 0.27
165 0.26
166 0.28
167 0.31
168 0.32
169 0.3
170 0.3
171 0.32
172 0.36
173 0.41
174 0.43
175 0.5
176 0.53
177 0.55
178 0.6
179 0.66
180 0.65
181 0.65
182 0.64
183 0.54
184 0.56
185 0.52
186 0.45