Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0WT19

Protein Details
Accession J0WT19   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
70-97ESSTSSQTPRRRRRDTPRPPRRSPLTQVHydrophilic
NLS Segment(s)
PositionSequence
79-91RRRRRDTPRPPRR
Subcellular Location(s) nucl 17, cyto 7.5, cyto_mito 5
Family & Domain DBs
KEGG adl:AURDEDRAFT_174483  -  
Amino Acid Sequences MDLEDFISGAPDNVSRVKIWSTRFDFDEIFYRLETVAPLGSAAAATNGVVAAPVSARPVTAVRSPSQPAESSTSSQTPRRRRRDTPRPPRRSPLTQVDVNVPGYETVAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.15
4 0.19
5 0.22
6 0.25
7 0.32
8 0.36
9 0.38
10 0.39
11 0.4
12 0.36
13 0.33
14 0.37
15 0.29
16 0.25
17 0.21
18 0.2
19 0.17
20 0.17
21 0.15
22 0.09
23 0.07
24 0.06
25 0.05
26 0.05
27 0.04
28 0.04
29 0.04
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.02
39 0.02
40 0.03
41 0.04
42 0.04
43 0.04
44 0.05
45 0.06
46 0.08
47 0.11
48 0.13
49 0.14
50 0.17
51 0.19
52 0.19
53 0.21
54 0.19
55 0.18
56 0.22
57 0.22
58 0.21
59 0.22
60 0.25
61 0.26
62 0.32
63 0.38
64 0.43
65 0.52
66 0.6
67 0.65
68 0.71
69 0.79
70 0.85
71 0.88
72 0.89
73 0.9
74 0.89
75 0.88
76 0.87
77 0.84
78 0.81
79 0.77
80 0.76
81 0.71
82 0.65
83 0.61
84 0.56
85 0.51
86 0.44
87 0.37
88 0.27
89 0.21