Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A1PG76

Protein Details
Accession A0A0A1PG76   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
128-147GCIFKANCKLQKRQGNRKSRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, cyto 5.5, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR047201  ERI-1_3'hExo-like  
IPR013520  Exonuclease_RNaseT/DNA_pol3  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0000175  F:3'-5'-RNA exonuclease activity  
GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF00929  RNase_T  
CDD cd06133  ERI-1_3'hExo_like  
Amino Acid Sequences MKLTGISQDTVDNSPIFIDVLNQFQEFLAKYNLFQSSSAVFVTDGPFDIRDFITKQLEHSNIDPRPAYFTLPWINIRKLFKDFYHQTQNKNINGMLEHLNMSFKGREHSGLDDARNLAYIAKRMHEEGCIFKANCKLQKRQGNRKSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.12
4 0.09
5 0.1
6 0.1
7 0.13
8 0.15
9 0.14
10 0.14
11 0.14
12 0.16
13 0.14
14 0.15
15 0.16
16 0.14
17 0.15
18 0.18
19 0.21
20 0.2
21 0.19
22 0.19
23 0.15
24 0.16
25 0.15
26 0.12
27 0.1
28 0.1
29 0.11
30 0.09
31 0.09
32 0.08
33 0.09
34 0.09
35 0.1
36 0.09
37 0.1
38 0.11
39 0.13
40 0.17
41 0.16
42 0.18
43 0.22
44 0.23
45 0.23
46 0.24
47 0.28
48 0.25
49 0.27
50 0.25
51 0.2
52 0.23
53 0.22
54 0.22
55 0.14
56 0.17
57 0.18
58 0.19
59 0.23
60 0.21
61 0.22
62 0.25
63 0.26
64 0.25
65 0.25
66 0.26
67 0.23
68 0.28
69 0.3
70 0.31
71 0.41
72 0.41
73 0.42
74 0.48
75 0.53
76 0.46
77 0.44
78 0.39
79 0.29
80 0.27
81 0.26
82 0.2
83 0.15
84 0.14
85 0.13
86 0.13
87 0.12
88 0.14
89 0.13
90 0.1
91 0.12
92 0.12
93 0.15
94 0.16
95 0.19
96 0.23
97 0.24
98 0.25
99 0.24
100 0.24
101 0.22
102 0.2
103 0.17
104 0.14
105 0.13
106 0.17
107 0.16
108 0.17
109 0.19
110 0.2
111 0.21
112 0.23
113 0.24
114 0.24
115 0.27
116 0.32
117 0.3
118 0.32
119 0.39
120 0.43
121 0.49
122 0.5
123 0.55
124 0.58
125 0.68
126 0.75
127 0.78