Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0WR77

Protein Details
Accession J0WR77   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
37-59CIAGKQKRDPIPKQRSKRTDVLDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 7
Family & Domain DBs
KEGG adl:AURDEDRAFT_19174  -  
Amino Acid Sequences HRRLGHVAPGVVKEMYQSGAVRGMRLAGTEAPLCVPCIAGKQKRDPIPKQRSKRTDVLDVVHWDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.12
4 0.11
5 0.1
6 0.16
7 0.16
8 0.15
9 0.14
10 0.14
11 0.12
12 0.12
13 0.12
14 0.07
15 0.09
16 0.08
17 0.08
18 0.08
19 0.08
20 0.08
21 0.07
22 0.07
23 0.05
24 0.1
25 0.17
26 0.22
27 0.26
28 0.33
29 0.41
30 0.49
31 0.57
32 0.61
33 0.65
34 0.71
35 0.77
36 0.79
37 0.83
38 0.82
39 0.8
40 0.8
41 0.75
42 0.73
43 0.67
44 0.61
45 0.56